S8&  @D* @ "b@ @@A# @@h/(" @K \@K O^a K`dh/H   @4 d  @+/t"@# h /H  @ p#|##b#a#`d#  |  G        /usr/lib/ld.so/dev/zerocrt0: no /usr/lib/ld.so &crt0: /usr/lib/ld.so mapping failure crt0: no /dev/zero 㿠@l !8/ '@    '@ #cx +`#@'&X #@ /&\ - % 7!ิ . & !&#P* " &cT" #@k$#P㿠/&P-8&c|* " P"c|)&/`@%#T@%P.`@!" *`@&#c\/`@'&$X@-%x+@5&@ "@l{㿠 ?/a!"&`&#h ?2&p@L֐"@""@u")@.@L@|6@U!&#` 23&&#`?" '-$,,` " c`&` "`@)@J 0"xH% &?/#c\ !&$#x!#$c!'!$@   a8-%  .`@ +% a/"+&`8/ @# D!! 8&/#a`*!/%!2/@2'&\2 )! 2+`-&%\@LZ"6@@ը @@3`8/`@'@@&c/`" @2!@ %8*"/0+G"- % . 0&*"#`8/ @q$%8 +'*+)! "-+a` @L"_@@L@~/8/`@'@@!5&/`&@@E%8+'*+)! 2+8/`@^@ '@@&Ὶc/`'@ +`)  , !!8$@@ J `-%`.`@%`25+&%cx@I -Ȁ"@< @A㿠@ʏ!!2a`2@ʃc(@VM@z!!"J!.@[@E a  t@Iސ. t@I.㿠к"@!"`@U "2@@H &#`?@ma`2@r!!!"!@@C㿠@T'&`?" $$cx9`+`!<@@?,$  -`@  $,,#x&*  " cP&#T@ 㿠@S&#`?2&&#"p?@##p&#cX㿠  * !<"@ ! ?! #@! ' , 8@o 㿠 8/    "2@L"}8/ 2#``,`@a:-&\"q@+'0G." *?0"&#\a/, "#\#\ * "@+`8/ '&#/`@/ $@@`8/ ' !8`*" !&#\ , /"%@! 8/ '&#/`@/ " @%8/ ''8-- %&c\.* #c\c\`+`@@$@JF"@"@)  - !<!@JC%*a< "@H!&@G #`?2)!&#T)%! '&d#a8, @I `. ! $#T%! &d!8+  @ `. -&X  "S+&cX!8/`@#/`@` @2 (%&@Kݐ"%&Xa<.@ @- :`@`.@ @- *@`.@ +(@@h @< * $$ '@ * " *6@`/`'@``-`@$*"!< .`, ,)!4"+  a0"- ,"  `/`/@ !!(/ `*?"% "'  ") !"  /@/  `-@Rb%-&h?+`#@%h/ ,,@h*"h+`@%hh- ,-: /Кb@!#@S!! #6$` 㿠&#`?2%#&&cd8*`@  @K @R@&#P&cT "%&ch%&P!8,+#-&T"chcd`!!8.  @ @Q`#.&$`$` ! 2:*& . .   !@  @$ 4`<`&@)@6 0@'* * /`/`@4耧@㿠6  2#"@ @4 @ 4ϒ@ #⬰ 㿠  ϐ "bϲ '"6   & @ܐ@ے #b@Ғ @ђ %$"" ""㿠&   : 2`@:`*`" @> 2:@:3  :?` 4`@@<`,`'@* @햒' @&+Ϩ %b@틐/`@@퇐7&@킐 "b 㿠2/ 4 *#`x 4 X.  * *   @ & % !)@[@W% $  #@T@R : 4 < 㿠@aא !@  @ }㿠0@ *㿠` (""@U" ` @ l&@`@H㿠#*!@ѐ *) *`!8j@@5 + @"  @+" .  @” /`@@ @". @㿠#*nb 8i/`<  @"(@ * @"3ϐ-đ* b@@z "c /`=@d Z@ڐ"U@i |Q *a< "I@] E@Y $A% * 89! / !<? @$+!8.  "'`'`4!<. @ + `8 SSS(SSSSxSSShS8TpTpS8. 2r㿠ɔ("b"##耐4! #! #b'  +`3Ϧ$$&b@㿠a@#  'x@>7h \ = "x@(bFP ?x@4‭R?^!= #``㿠@# #a8*`@@ + *@O# . 㿠@m#-=. @u @=#! *k@5#1 /`@c:@ , ,`Z@@$#; . @m! 3` .- $ @=@ "`$ 㿠@2#Ja=. @ @e2@ c`f2 x@@#K- . <@cT%!  .,@  $ @ @ %$ 㿠a=. @ @d*ǐ8@#U@ "@@\ (@`b:@@@8"  b2#Z#d@@H )@ b@B @`b: /) . !<cj . <ckW㿠a=. @ @c"@#n@ "!@ ! . !8@` #s@#) . !8#@o㿠@#a=.  2##@\ a8.  @R#㿠 @G#!<. " ?-@ϐ )㿠@^#a=. @ @ "#@+#@^@#`9  .+    ' !!<. @C@  |%`'  ?- ' @7@ "`' 㿠@,# . 8@L 㿠@ # . 8k 㿠@#%` .*  !$!8. @$`$㿠 (*   Ⱈ#@Ő# @]!@"(#@#c`@$%@#*M+u/Iq/<m/Qi/@Ɛe/a/]/Y/8U/zQ/DM/~I/E/'=@h?/@i;/@i7/@i3/@] ./a<. `-`aH ```` ```p``0```@`P````````````````````/8. j㿠#<* I 㿠a8. @ @ 2@ @\# '@㿠a8. @  *`&#|""#|# * a8 ݐڒ  /`@?@ А@π /`?*`@ 2@\ /`/`/  %'/8@@" @  *`?@  + ?@'&㈣,`@2@@@ /`@@" '@ /`@?@  * ?~ |  /`@?~@ /`z@?w@ k *`?@ * k@ +`?@`*  a@ ,*@ X@`2@H `C A >  *`C@ + ? 3@> - @@ * a bbbbcd(cdcf0cf0f0bdDdPdddddddddeHdddde<e< @[ 㿠@Z# *!@ZǶ@[ '8 +`@@`*` *@"` "`@`-`@$ $ '@ @Z  @Z #a8 *`@  / #`#``*@`'@@ '@-@Zΐ !!< * @?,`$@/ 'j'@Z  e@Z a8 -`@ ,` @ ""|@P'@Z ! / !<q.&?k?>&@Z  !!8+`@'&㈛+`@@ `-#@@Zz  !!8*`N@* "@= !<.   +at ffgg,hih htgh gh h f$'`a8/   ,`@ $`$`!8-%. 28--%  &#|""#|㿠! "* b jjjjjj " #!  ## $a  @!&ch8,$ ch`-`@ "ch5 .`"&&h c* *㿠! `c2   @ !&ch8*" ch+`@ "chch*`*@ 㿠"t * ` lpl`llllpqo4rpmq8rlll@9@:ސ H@ I@:@@ 0#K"a @ @@| @@v @-H8/ !͞"" #@9_a!"h)&$$"h#d-  @ @C"h3"`,  >@YS &'8h*`"@ + 3%",,bh`.`@ -`*-`,  h `-`%@ `*`.`&@  , $h - %h* "@Y &ch`*"ch +`@`"chch`,,ch+ --ch`*`"@ Ɛ @Y#`4@0%@:) U@ @:/@ '㰀@)@+@8-%! %aЀ" &@: o@ڐ @ @ &#h ?"#!&d8*  .`&@ #!#c%2')% X!c`/8-`%@0"`"`N"!@B@@@!#a@9Ð @ @b @ )@@@8eG@5&@8]dh%#"h8* h" -  h* @@B@c  *"+&- - . &.}&@ly@8)3bh#"$ &bhbh!!8,`, $@m bh.`@.` ^&@?.@X @@2 @- M.`@Hh" * *, "" @X5`2&#hh" *  '&h+ !&#d / @@ " / @1&/ @@#h2@/ '!&#h@X $#h@: 㿠@8 "t   "   @$ $ @@y@8!` "`㿠@Ð ߀" "h"* " @ ‐" "h"`* " "h` ,  $"h * "   @A 1"h9! 7". &"h`@[""h㿠@C ! a 2@%!h"`* !"&#a`$%#2@'@$$@8s @I@㿠! * bl v|vvx@oaؑ*  #!a+`#@ @a#a'أ,`@)%!+%a-&`&1&/&`#` `2 5&@@@@8:`2&&cd``` 2 &@@t@@8&h &#h<+   " +&#&ch,` @`+&cd-@:!1!&ad9!8.bh"`*`@ bh`+`@~@ %($', " ظ ,@`8ئ,!!a8`,`@ * $@"! * " @>㿠 " &@4+ bx ""V@4" " <@4 ∀  ؔ @3 u㿠&cl "```?  3 &ch8+ # ch,  "ch@>o e&#`" #" &ch"``a8.&`a8a`*`"@ ☀"!"@ !  @N㿠!2V !8*`"@ &c` &!&&`#` `e'&#$p@_ !8`- % %&h8.`&@ h*`@ #h㿠&#`a`$"@4@5/!F@!V@ΐ!\@@5/ @@@;" +c㿠&#` e&#d  @2@>@ "㿠&#p? $+& *!8)&+#p/## h   3c`.`!8&@&#h8*`"@ "#h&#h a8+`#@ "  .  " 㿠! & "@2@4!w@y!@ @@4#!"h#a!" +`#@"h?""h@1 @K-?@=]&#`" " 㿠 @ @SC %</` * * `!!+ #&#h,`$@"#h㿠@%&J!h8*`"@ +  $@~,㿠&#` 2-+&&#h ?@2&+& ?"c a@<@0 2%!!# $`$ ')% $@40Hch-@B/&h!<-  8&d  #@ : $@$&+&c`&/&-&``  2&@2e"M@/"[@r @2f#h8* " 4 &ha=** @2I"i@m@2O$&#h"h$ ""h-h"%- @%@/ @:&#`?" #" h@b"a@ؔ /  1 + #-*(!= .P#bą"/'   *  / @! " a` "C2a@B @a@6@"&ؚa /`@ `+` @'(+(a=// P̕*' @*  +` +` +`+`@@.`@@ 7`/`@ @" &@  @v,&$&@#``0?3#``T?;#``؅\? 0č&`8J΁=0୥ԭ6@ZމD? 0 Ƒ(`@LЭ?賠X'=  #``* +!&#h,$#&$#h#h --#h.&&#h #a8+#" #" 㿠! &!!` `@1"!@a!$&@G@[@1 !@!` 6 @0"! %" !{ $@0"! -$" "}%@W@:㿠@0ِ"@"@Y@0㿠@0̐"@"@X@0㿠"t  @0㿠@0"@t"@B@0& "c #"" " & "c[ #" " & "c #" " & "c  H" k" " & "c  " " aJ" a" " & "c !" " " & "cK" & "cn "" " & "cϐ #" " & "c  #Z" " " & "c" & "c" & "c*  e" " & "c  " " " & "c !E" " & "c" & "c !" " & "c" "\" " " & "cː #" 6" ck" c" " " & "c  G" " `" `" " & "c%" & "c[ !" " " & "c "" " & "cC "|" " & "c" 7ٶ . !. ". #. $. %. &. '. (. ).  *.  +.  ,.  -.  .. /. 0. 1. 2. 3. 4. 5. 6. 7. 8. 9. :. ;. <. =. >. ?. @.  A.! B." C.# D.$ E.% F.& G.' H.( I.) J.* K.+ L., M.- N.. O./ P.0 Q.1 R.2 S.3 T.4 U.5 V.6 W.7 X.8 Y.9 Z.: [.; \.< ].= ^.> _.? `.@ a.A b.B c.C d.D e.E f.F g.G h.H i.I j.J k.K l.L m.M n.N o.O p.P q.Q r.R s.S t.T u.U v.V w.W x.X y.Y z.Z {.[ |.\ }.] ~.^ . ._  /@`@( ٖx @  /@`@ ِ  l* ? *? *?@`+تcx@ -ِ x @ ~ @ؐ#x`@. ِ x @  @ؚcx`@+  㿠@.&@"&#`ax " !&@7k#`@"#`"x!@a@l }@.# 㿠 r͑. 'c\ (<Xt0L`|$`hp|PDXlLLT(XPt|@8dXl @$0DDTlp,p ptX @}"P@P"@ӐI@I# @̐B@B#@Ő;a2@`#53@4#:@-a2@R#S%@N#V!@!#[@@#v@@#@ @ #@#@@#@@#@|n:o@'*&n: @#@&n@ #@&o`…@ *8@#@&@ @#@#@ @ @ @ݐ &@ؐ 0@Ӑ 9@ΐ A`ٲ&@ `.`)`  DXlE@ :@'>&@ @ I`E@&@ }Y@:&@@(er@ O#bY@&@j@ Ue@ \`@ d[@ tV@~ Q@y L@t G@o B@j =@e 8@` 3@[ .@V )@Q $@L @G 2@? @; @6  @1 @, @'!@"!@!@!@!@!(@ !0@!?`ԑ.`)c@  @!L@!W@!`@!k@ސ!t@ِ!|@Ԑ!@ϐ!@ʐ!@Ő!@!@!@!@!@!@!z@!u@!p@!k@!f`2@!^@!Z2@!R@{"N`2`@s"F2@l"?@h";@c"6@^"'1@Y"1,@T"='@O"L"@J"\@E"m`.`*b< 2`@."x2@'"@#"2`@"2`@"2@ "@ "@"@"@"@"@"@"`.`*c  4H\@ِ"@Ԑ"@ϐ"@ʐ"@Ő"@"@#@# @#@#@#$z@#+u@#2p@#6k@#<f@#Ca@#K\`Y.`+a, 0DXl`2`@h#R;2@a#U4@]#X0`2`@U#](2@N#b!@J#h2`@B#o2`@;#s2@4#x@0#}"@(#@$#@#@#@#@#@ #@#@#`.`+cL @#@E@#@>%@2@ې#@2@Ӑ#@2!@ː#@2a@Ð#@2@#@ /@U&@@ 7ڱ.`8@9ٸ#ې @r@s @@n i`2@ !a@ *]`2@ 5U@~ >Q@y JL@t TG@p \C``"@d g72@\ u/@X }+2@P #@L @ 2@B @> @9  @4 @0 ```"@$ @ @ @ @ @  @ @!`2@!@!@!@!#@!(@!.@ސ!2`.`,c h|T@̐!:@ǐ!@@!E@!K@!O`.`-`p (<@!Wy@!]t@!bo`2@!hg@!qc`2@!{[@!W@!R@z!M@u!H@p!C@k!>@f!9@a!4`.`-a  4H\p`d2`e@K!2`f@D!2@=!@9! 2@1!@-!` 2` @%!2@!@!`2@!@"`2@"@"`2@"@"`2@"&@",@"1@"9@ې"@@֐"H@ѐ"P@̐"Y@ǐ"c@"m@"w@"&`` .`.`t <<(`2`@"o2@"h@"d@Rʐ`@"[@"V@~"Q@y"L@t"G@o"B&``.`.a $8L`2@Y",@U"(@P"#@K"@F"@A#@<#` .`.b` ,㿠)#%!T J@E.## J@E.#0 J@E.#8 J@E.#I J@E~.#_ J@Ey.#p J@Et.# J@Eo.# J@Ej.# J@Ee.# J@E`.# J@E[.# J@EV.# J@EQ.#˒ J@EL.#ג K@EG.# K@EB.# K@E=.! #@E6 G# G@E1   G@E,   G@E'   G@E"  ' G@E  1 G@E  ; G@E  D G@E  L H@E ': Y H@E'; c H@D'< o H@D'= } H@D'?  H@D'>  H@D'@  H@D'A  H@D'B Ȓ H@Dܔ'C Ւ H@Dה'D  H@DҔ'E  H@D͔'F! H@DȔ'G! H@DÔ'H!+ H@D'I!? H@D'J!K H@D'K!O H@D'L!_ H@D'M!i H@D'N!n H@D'O!r H@D'P!x H@D'Q!} H@D'R! H@D'S! H@D'T! H@D'U! H@D}'V! H@Dx'W! H@Ds'X!ϒ H@Dn'Y!ܒ H@Di'\! H@Dd'Z! H@D_'["  H@DZ']" H@DU'^"* H@DP'_": H@DK'`"A H@DF'a"O H@DA'b"] H@D<'d"m H@D7'e"x H@D2'f"| H@D-'g" H@D('h" H@D#'i" H@D'j" H@D'k" I@D)l"˒ I@D)m"ؒ I@D )n" I@D)o" I@D)p" I@C)q" I@C)r#  I@C)s# I@C)t# I@C)u#! I@C)v#4 I@Cݔ)w#G I@Cؔ)x#S I@CӔ)y#b I@CΔ)z#o I@Cɔ){#} I@CĔ)|# H@C'c# I@C)}# I@C)~# I@C)# @@C # , @C-# -@C # Y@C #’ (@C #Ғ )@C #ݒ =@C # @C # j@C # W@C} # L@Cx    V@Cs `ȓ*`@ @`a#`#``+Ϫb,9 ' 1&"83a 5&  @CT    [@CO    B@CJ   ' >@CE  @ 0'?`cȣ,`@ @`""  9 e@C1   E @C,   L $@C'   R '@C"   _ %@C   f @C   k m@C   s m@C   } m@C     m@C    m@B    .@B    @B    6@B    Z@B   ɒ "@B   ђ f@B  s%, @ '?   7@BՔ    ?@BД    S@B˔    *@BƔ  ! O@B  ! A@B  ! _@B  ! @B! @!#'?`/ȫ-`@@`%в&` !)&` a@B  !0 l@B  !4 F@B  !9 &@B  !A !@B  !H 8@B  !P #@B~  !V @By `"!|!| # !Z X@Bl  !` X@Bg  !f X@Bb  !k X@B]  !r N@BX e !~ N@BS  ! Q@BN  ! Q@BI  ! R@BD  ! R@B?  ! R@B:  ! P@B5  ! P@B0  ! P@B+  !˒ P@B&  !ڒ P@B!  ! P@B  ! P@B  " P@B  " E@B   " E@B  "% E@B  ". g@A  "4 g@A  "= k@A  "D k@A  "Q k@A  "X k@A  "` k@A  "i k@A۔  "q h@A֔  "t h@Aє  "z h@A̔  " h@Aǔ  " h@A”  " h@A  " h@A  " h@A  " @A h " h@A  " h@A  " h@A  " h@A  "Œ h@A  "˒ h@A  "Ғ h@A  "ڒ h@A  " i@A  @P"'?`,`@@`%`%` " i@Ao  " i@Aj  " @Ae  " @A`  " @A[  # @AV  # @AQ  #  @AL  # @AG  # @AB  # @A=  #! @A8  #) @A3  #/ @A.  #4 @A) c #: @A$  #C @A  #M @A  #S @A  #Y @A  #] @A   #b @A  #j @A  #q @@  #v @@  #{ @@ i # +@@  # +@@  # @@ c # @@ޔ d # @@ٔ e # @@Ԕ f # @@ϔ  # @@ʔ  #Ò @@Ŕ  #ʒ @@  #ђ @@  #ْ @@  # @@  # /@@  # /@@  # 0@@  # 0@@    2@@    2@@    2@@    2@@   " 2@@   + 2@@   5 2@@z   ? 2@@u   I 2@@p   S 2@@k   \ 3@@f   j 3@@a   q 3@@\   z 5@@W    5@@R    5@@M    5@@H    4@@C    4@@>    4@@9    4@@4   ϒ 4@@/   ޒ 4@@*    1@@%    1@@   @ '?`.&`&`  !@@  ! @@ !`!Ϡ"+`@?&`` ,%%! @?! @Ő! &` ` ,&`( * -"? *    $ $  $ r,`! \@?ٔ  ! \@?Ԕ  !" \@?ϔ  !) `@?ʔ  !- `@?Ŕ  !2 `@?    `@?!7 !< ]@?  !@ ]@?  !J ^@?  !R ^@?  !^ ^@?  !g ^@?  !p ^@?  !x ^@?  ! ^@? !# !@? T ! T@?$ ! T@?}! ! T@?x" ! T@?s# ! T@?n&2 ! U@?i? ! U@?d? !̒ U@?_? !ݒ b@?Z  ! b@?U  ! M@?P  ! M@?K  " c@?F  " c@?A  " c@?<  "' c@?7  "5 <@?2  "= <@?-  "D :@?(  "L :@?#  "W 9@?! "a 9@?" "k @?  "p @?  "x @?   " @?  " ;@?  " ;@> ` 1&"@ǐ"`8&` ,` p,` "$` ;@>  " ;@>  " ;@>ߔ  " @>ڔ  " @>Ք  @"" %!T㿠@+ !aa  "!# !$!㿠@?5 #a8"/`' `/ b`/ H`, $""+a "b"3b"H㿠1"!8 *`@ #cH * @%ۦ $@+%b@  @?&"㿠&x "x@7##Da `i2!"#&'`@&a`i"!! h`$cx㿠"쀦@2"b쀐2 @!"/ !8@ @ / / @㿠y"a * 6`h ججــ$dۤd݀ݴݼC 8 ( !!a1 8#!! (#$a'!$2 -)!2  L@2  E 2 @"1 @" 1!@*! al<*  >8  "@{"ې hJ@i =@ 2 @< @ <a@ 6  !!@2  @$  逦=>"%@)! -&`&1&/&`#` `2  ܺ &` &&&`#` `e2  ̺!&#`&%&#&c`` `2  +&c`6  @/"د- 2   2  2 #!>2 : * &n@ܕ2:*& n@D} @a` =2'@!! 2'@ '@!@!@@$!'n* )!-&-  % a@I@a@9!`! @5 @@ "@Ҹ'  / 9a  h@ C@ C@ɐ@ D@ D@܀& E @ H E @ H܀& bY @ג IY I@܀ @Ò J@z J܀ @ K@i K܀& #! @ G`@S G@% @#瀐 @ #@@&'@ n@wn n@/h) +a`F2 @/-!@@&ua`  ?! F2)@# G#!!`'$)! G++a/ȫ-`@2&  d@-$ܒ d@ܒc. " n@ܔ n@Ґ @!#  @ a 8+`@ 21  d@ؒ d@!c,$!"c ـ@2@/ '!&#/ "}@' / !{#!,#!* " n@ɐ n@@0a@a@ːa@@  @ϔ a@a@@! K2  @@ t@~ t@?xa@2! !2'% 2-+ c#22 1?#@!!!@ʺ@ @x!6E@ * !$! @ݐ @~!aE@ :    -@~t@~@@#!#@:"2 w@# w@ې܀@ w@  w@ʐa@a@%@'@j@/@ w@ w@@ @&)"h1/!-"-  %bh!" *`"@ @9@h@@@@@!@!4/ $ @8 %<. $@/    @ ' #a8!!-`%@  @ !`@/ ' ؔ@| usܐ ؔ@4 um@Ad@>o`@͐ !@~!  @ !.P&#@a%@~@r2 1+a)"H.>&!/ۮط.8&@5@1 @ C,!" F * <` ((4dH"4!"4@"$"4㿠!@*  !+  #a,`@  !`"!$!㿠'D!X",!@#a`H* K8!<# HX"! @U J!"a @| Z @=@PQ@U! * <c  8P`!`E "Y  !/؀X2 @}Z@~ cZ"2 @Y @ Y2#ȗ. ! "!@Y2!T!cȹ. x!#a8 , *#+ 2`.*@!<-- @ @@ @ 2 @ *? & - -  ,?" !- & --@!. !8 2 /@!=@ @@@2 @ /  @&@:! /   "!&@/@!`$!@:!Z2 cȑ. !!Ԃ N$!#ȑ. !ԟ!F$!#Ȼ.@տZ!`%8*`@#ag ` + #, a^  *"`/`@aU  *`"@%`+ 8#na , $`* fa +`/`#@^a +`#@"!b " D @ f@$@ `a@a@Un` t@c t@㿠&#`&&&c`` !"@ ,)@|a`   @f !&$#p@Z#a$  '%$ ) @ z@@P!!+&%cp㿠`&* * #` P  "  "  "  "  " " `/ - -P@@/ / / /  `2&@|`@ 6 @|  @{F @|@!! '`%&+`+`@@@``$`$` $`$ `$$㿠@|/!  @ `/`'@ 㿠@|!@2a"8#!㿠@E!@| a  @ @ cȻ/`@ @ @+a@)!8/`'@㿠#@(`*ϖ⸫-%@ * % @  %x  $x@z @z2%$x'"    @b @   V@A V@@{@'    @{""   @R $ @ &/) @ ҍ @zW @@ @{ ۀ"<@.!! $  %' $ ) @ @@"!<)%#"  &5۰ ۔"8#٢c   @9cX"@2cT"$@#˒""`@ ޸ cXT@ȯ- %a/`@ #``#`'@ 㿠#L$`L@ " @*!@z  @yɐ!. @yԐ!1@L!@#L#L@ $耐 $    $ @ !V@B@  $@#!$#L㿠@v<!"PP 2 #"x #x!#"x`""x㿠@ _!  a E@ N! a E㿠@}!aۖ*` @`" ۞ @'@@z~#@%%b0@2'\)%"0#XcT@% 0@>+ۀc& '@㿠! @ #bx $bx!@H!$bx@y!`!" `@  !@C@^%#(`/`@- 3c%@`F(7@u ㄀"@@v @x!@"$$ @B!@xbЀ "۔ ""< "@r cP`!ܞ $"<@p@/#$c -$"  (* 1& 㿠@"Ё㿠! @o a8*`@ "1! #&.c@:)@*`'`` :@,cȦ  "@7`/`@@ .`&) 82#&!!#`8-@[ !#*"!"#㿠!*  7@@>@|!@ @x_!@x!@u =!ء,  2 @xB!&!+   @|! @xC! @2 @u =@d'/@ @x2!@I!0@z /@f  @r!#bx`2/%H4 / ! $"x@x! $"x/P6 71&&#!&` "!H@@@R& "c   !"  1"  bn"  b" "  & "c"  & "c" & "c 9  #f" "  & "c"  & "c"  & "c"  & "c(" & "c N   " " & "c    " "  & "c" & "c D  !" "  & "c"  & "c" & "c   "C"  o"  b" " & "c А  # "  9" " & "c e  #"  "  c"  `1" " 㿠" Pݐ#p(@ ("! @ "! ! $#pPߐ#p(@ %#$"H""H㿠&:2 pcp:* p!ܘ #pp"=`5=`#p)ݨ#p`,#p9ܲ`"#p#p"2> > 2 : * &:3  #pݔp:*@ #p#ܚ`"#p#pb2> > 4<,&=5+#pcp=-#p9ܲ`"#p#p"2> w> 2:*cp& /@cpܖ#cpcp✀@c㿠! cp 2 !p "!#p# "#p#p#p +#p+ܤ"#p#pb>㿠cpݒcp * cpܖ#cpcp✀@2#*##pcp& ,#p-ܦ"#p#p2#p!. @.@#pܔ##p#pb 2##pa@-+#p"#p#p255p@-pܒ`"pp" 2!#p!@++@#p"#p#pb2--٬@/ۮ@3ٲa@#(*`@)ݘ + #p# #p,#p3ܪ`"#p#pb255ڴ8@@#(*`@@+ݺ`/`@#p'@ cp-#p5ܬ"#p#p2#(*`@+ @ #p+ݪcp-#p"#p#p"2n%+(`@  ڔ8.  #(+ #,`@p5ݴp.@pܒ`"pp" 2@-,(`@  㿠@0q !8*`"@!! #cp``+  #-@ܐ"T '@-@ݐ#h '@" @ "%#+a8"Y`.@$`` q,`Db Ц,bH &]% $ 6@ ݞp@@'` `/@< .$/`@@H &=%@a @ <#!@#ݢcp@@  /@ .%.`@  "``*`Dcl DDDD  8@2~#%< -% + @&#p#p`-#pܔ##p#pb i& ! @&4%#pp`,@#p "#p#p"2M6@ ; 3`@ #pp; * #p%ܞ"#p#p2> 3> 4<,3&& `&!-pp`-@pܒ`"pp" 26@ #p#p+#p)ܢ`"#p#p"26> !: 2`@-#pp: -@#pܔ##p#pb 2> > 4<,!#p#p&+#p-ܦ"#p#pqm!</`.  " 2/'##pcp`,#p-ܦ"#p#p2a8/`@ @H@`/`   "  ''#pp` ,#pܪ`"#p#pb 2/`8@ @@@/`   "   ''8/`@ @@2@㿠"T"+bT`*`!8@ @&+)"T *  @/S%"T"T2+ch-h5-8 !#h /`$#h@/:#h2-݁@#!= /`@?@?@"|""|"|$pp +@pܒ`"pp" 2b|─@$"|"b pܔ 'bx3'0cF0''  p? `x %8+`@?`x? p?`x?`x *`@'' / ?@*"xb " 'x)" " x%"b⌀@" ')"" y %"a \F ?bt`+`@* H?諠T#``"\" ""\a=  d*eܐ .  2  *   #"d.  "`*$K"\$Fܐ"\ ܒ` " x  d  'xx" @@$xx69"x3""x@"a@" e2 5!"x3 @ ;  ""x'*   *`@q`$@r&6"x; @ ""x"x ,8J ܞ"⌀ " 57⌒ l" &"bx@ " 5x7− Z" x&"#  " @O#`#"""b""x"x$%` `*  "x ""x`/`@ @`h"" "h@:a \F ?"t *  @* H?ૠT#``"d#@ ""d!=@@d*Iܐ? . @ `2   . #\""` *`+`@@  $-"d $(bdܚ` "bd"bd@ d %@Ӑ" @֐$69"3""%d@#ad@#@`e2 7a"2` :` ""%*  *``@ $@&2 @b: "bb@ ,@8Pܖ@ ""x"x"" 7x9""  x'""bܞ "bb@ " 79" " '""#  " {#`#"""bxܸ' """$% `*!8 " w""<.`@  p* L`  ((*11111*L1*\/"\ 2"b\`bdܖ "bdbd" ""bd $G\ $Bx" " %x'− " x$b@ " %'⌒ " $#p#p +#pܔ##p#pb 2B"d?"\ d""b8.`@ 2b| $"|#""|㿠!p$@i @m# c`?$@i  @ @j @j [ɘ! H   $' '` !ɶ!@m76 @jw . !@p"$%p$ +@ji ]@ W@  + /`a8@@3c4  /  4 @#b@@@ 4   - 5@@ $@ @  @@ p 4@ @l @ ∖ #a$ @+b@@/%5`@@ $ ݶ #`#!$"#b%$x'$)"L2!+c2-D/%@"h@13܀ &bPbh @  @13܀&bP@5&L"2@qa #p#pݚcp + #p'ܠ "#p#p✶@2ɐ! H$@`@!"$"! .!8ܴ #"#c .  '#pp ,#p3ܪ`"#p#pb$'#pp ,#p3ܪ`"#p#pb2"ܴ""?"|p 4!@ik ]!#"8@f"$Ȑ㿠cpݒcp * cpܖ#cpcp✀@2###pcp ,#p-ܦ"#p#p2``"!ɠ  #bx%$p  $bx@k!@k 0@i( .@l> (@i$ .@l: @i  : @ <@l3+ @  <@l.!p$bx#pc(*  ݔp$ *@ #p"#p#pb2-D-1#(- 5@#p@ݔp*@ #p!ܘ "#p#p"2%   `#`'(,`@+%`㿠"|?$7b| $'#pp * #p#ܚ`"#p#pb2#pp ,#p1ܪ`"#p#p"2"`"""|&""|"|?4b 2 @k!&#pp * #p#ܚ`"#p#pb2##b% !#p`$$bې"3 ! #pb1ݵ>`6>`#p-#pܶ$#p#pb 2#p"; 3`@ ;`+`# * #p%ܞ"#p#p2|#p+b=`5=`,#p5ܮ"#p#p2g#p"ܓ: 2`@:`*`" .#p##p#pb 2Q$1!"%ܤ, ""% """4!1#p#p -#p"#p#p"2(L"#p *@#p!ܘ "#p#p"2%%p#$@ ``$/#pp -#p9ܲ`"#p#p"2'`'`4/"(2 Pߐ#p(@ cp "  pPݐ#p@  @j!:@i"L @i!M!@j." @i!P" " @g s @i!V! p@j5  @i!Y@q"P"bܔ?"ܘ?#b|& "c b  !" " 㿠 s. Oc ???@@$@8@L@`@t@@@@@@AAA( @iҐ!Z @i͐!U @iȐ!P @iÐ!K @i!F @i"A @i"&< @i"<7 @i"E2 @i"O- @i"W( @i"d# @i"l @i"v @i" @i" @i"  @i}" @iP"㿠 13. Pat B<BPBdBxBBBBBBCCC,C@CTChC|CCCCCCDDD0DDDXDlDDDDDDDE E E4EHE\EpEEEEEEEF @i8" @i3" @i." @i)" @i$" @i#  @i# @i#" @i#6 @i #D @i#Q @i#\ @h#n @h# @h# @h# @h# @h# @hސ# @hِ# @hԐ# @hϐ# @hʐ# @hŐ# @h#@h }@h x@h s@h 'n@h -i@h ;d@h I_@h VZ@h hU@h uP@h K@h F@h A@hz <@hu 7@hp 2@hk -@hf (@ha #@h\ @hW!@hR! @hM!@hH!- @hC!9@h!E㿠 . Qb\ FFFFFGG$G8GLG`GtGGGGGGHHH(@h!bd@h!l_@h!yZ@h !U@h!P@h!K@g!F@g!A@g!<@g!7@g!2@g!-@g!(@gې!#@g֐"@gѐ"@g̐"@gǐ"+@g"6 @g">@g"Fx E /@`@( ! d* c"?   *  ?a@``@# # `#` +``ؐ#8*`` t+`@`@"` "`a8 u""a8"" * ٖ  * #Ȕ **`@" """  v* a  * #Ȓ`*`*@`@"` "`" w* * #Ȕ0**`@b@``@" " a" w*  *ceȓ*`@ ``@#` #`Ÿ`(  &&#' `! Ț $  $  $"$"x ǒ``$  $# !  $?aȺ 0@' `"a`  !  ` ?%! Ⱥ A & &@%@%` %@%$&#' ` `  cȔ2*+   '@`@*'@!ɠ  #$ c$? $  $  \$  $ )'?'@`@(?bE #Ȓa*`*#c`@'@`@('@㿠"hbl ("h""l"l"R(""@_"X"`"h +` +@"h`+bt,,"h5x* " 7p2"@B "h;'bx""t "p` `*"p"h#"h㿠 " n 7* Sb NNOpNOpOpOO,Oh&*  2@?.  $`&ľ'8. @@@@@!`Ľ㿠bhl`@ (h""l"l"R("@"X2 h#"`+ +h5ȯ. " ,$$h `"hh**"h"`+# "h`,, "h`""h㿘ͻ.@  bp` 2 +@ `" m"  / bp`(/./ pc//@ '@ 㿠 x& @ bp " #@ p/@#cȱ. &㿘#cȱ.  `" 4" ` .``.'@* cȔ#x" " * 㿠"hbl ("h""l"l"R(""@;"X"`"h +` +@"h`,,"h-`%@ "h`""h㿘 "p ( "p#""` `*"p"h `# "  ,   "{  /`@  *  2!!@F$!\$!"h +   2 /"h."h%` ""hha@`-%%@:*1ͻ/`@ 2#bh'",`@@``" " +@@``" " bh!" +`@@`'`'`#x'@ ""h+  Ȼ/`@ '`'`-"h #"# "  `,   2  `-` @3&bt * #"x@"㿠"t @"!ra@SM@@"`@""t   "!&5&"}/`'@@a })&㈘!/`"'@ &㈠#$/` $'@@a#'ὤ/`@'@) 8@'@@/`,.'@"@d'@c" @ @@Y& "c" & "c #Q" r" c" c" " 㿠@p "x"bpH x "x# ""x`Ѐ   Ё㿠@c "@`K"p"bx㿠#P@c @c㿠 Ѐ  "@a& .@P2Ю"@ 0  @G@c @)bȀ@F#!"Ȣb `a*'@`' 1 '* V` YYYYYYYYY\\\\\\\\\\\\t\\Z[H\\\\\\\[[[\\\\\'̀)!!a! " # b!"Ě` $'@%#bȤ @`0*'@)"  98 '@/`ȟ/` @@ 'b ``" '@~M'@`'$)%!"!!"` @"@]p# "&4f#c 2%&@ @!  @b@_w%&`@  @K@'"Ħ$ "`""Ȟ  *@b @(!"#$c"'$"" {"c"ۺ'`Q##P@b ' Q R S"@b 5"x#`""x ? K@b@b V@_(!@"$R!"@o6 %ۢ $P@C!"!! d2 @bv Z "P $"x# ""x㐀"%&@^'& @!  @bV%&`@  '&@^$)#Px "x@^㿠@b/ @b: @b7 ""@b!!`̀ "@b'!@b$!T㿠@b!k@b\@_ )o㿠#" "x #"xc 2@P"x$ ""x㿠@!n &"c" Pۘ #cP1@-#@$!" e * ac \D<#a`r:%@&'$@}"!"b"*# 㿠  !@|$!!@|$! !,#㿐!'* 8 &cx'c' "cP $&@S@{#@{w &/ # "& "#x`̓*` @ !"!! p&`" #`!0 &c/ @ @@/ m:@   8'm,#` @rT&#. 28 .@@m @:! # " "T2D#@Y#@V#@D~@v.` 8&#&@ . @/`" @ @&/ @ ! 2`8@ &#/ /`@ 2`8@  @2&/ @!" 8.  !2a䀢`o" @8! "+" !#:nabM ㈀2@vZ `8/` ##"8.`&@+a&c/`@q" a!@ 2a䀣`o" @! #" ac::&ɴ2@v# 8.`&@ !&㈛/`9#@@{ @#@V, @?!  n`" #!a#@{&!*  &.@ @.@m@u.` 8&@&/`"@ &c.@ @.@m "=@2&㈕.` :@" 8-`#@-"%.`%#%%!P  `@UА &@SS@U@U '@ @yK# @n2& 㨀2#2 @z 㨀"@z c# 8" . 0"?! ("!! * *  ,  a@@`a0@+`  #@ !"!&#x"c㿠!䀢 n2@{~ ?@#@UI W@;@z.  "@ .   @y@`@㿠! c( ?@pa`c 2 #a* !$!`%@)%!& "ce  " " " & "c !J" " a" " & "c "#" X" b" b" " " & "c5 #e" " c" `" " & "c4  j" " & "c" "" "b㿠 ` 2`/+ 2 `.`"  "2 !" 2!`#! %  *) )  ,  `" 㿠 0  (   2!#cT !$#T -`"   +c(* "1"2 3a5@^&07&X;'cX "b#(*@^" #0㿠'L5('D-,`-+`@* .`$@#@ $ h* = h   !٠ xN/@`  `-c( - ᰚ` @ #٢`xN/@`  `-( - !@ %٤xN/@`  `+)%!a.@㿠@SM@SK@SI㿠!#cT"#X"0#XcTl0㿠 a  *  ! a O@'ئx #`, /`" ᐸ `@]㿠 "cB  ! (@x !'#c㿠N i2 N `n2 !@SB#XcT}0@S*!-\@ 2@y@S.!0@SP6-!E@S!s@2e"bк@ @ 2)#bĀ6 )`@  "#)"%Ѐ @K@)"İ `t+b0-@2/%0#XcT0㿠h"0a 2\"0#XcT0@x@2 #(+ 1#@x!"0#c\2%"0#XcTt0@x)@- #- (%@xc\P!v@xp@ #(+ #/%1#23cT!$!7X9@_'#!a "@c#(*c+ے`*`@c"@ @ `F(/@N ㄀1"@@O @Oސ (!#@Q !@א"$ !,? ?"(/ @  @qa &?$? "$ c!!+@# '`$?/"? %x"xc 2 ""D#c]!@逐 #a!@|逐#[!$!% $xa@ 'ᤀ2@Q!@Qz!@Om !ɠ!@R  @Og a@l  - % ,  ?!! "!!" '+'T"!` ! 6a` ` *@! ! "  ?#a` @@.a!*  Ÿ @O !ɠ!@Q @O ?@ <@R%'@O  :?@ <@R/,,+a$$ $$ !@Ql$"  Ȁ2& "и @N @M)`%"x㿠ccc @ `&2' ! "  "ĺ  ,@ @` " `@ ` 2`#@$@-逐%@!!@"$!@b 1 @&!3&a@" 5&  !"к@@@ٞxN`@/  /'٦x# `L@f. `M. `J. `J@. O&@`."㿠@d"9 " @$@Y"C " @$@N"L  @$㿠 @@ N@ ".N@ /@``!"8@3bW' .㻠#a#(.a`,`@    @d2N"}$N#/a)`,`#(@`  d2 :"$ :/@ N` d2/"s$/N` d2"e$/@  @ʒ8a@Ð! * ib (4H\"a " #a!$!#La`/" )%L.2 'L᱀/2)%!!@+@*%a  2!@"  !@b"  "@`/ሀ28! _ ሺ J:  aK@ " h2"ے h! L`.!J :2逐2 h2 ."Ē h ./  h" h //` '`N /"逧 h2 /" h //& !K 2#!"!% $ h'ᰀ h2N"킒 hN1.!`@  h2"q h/!@֒ ' "a㿠"#@Y""c\@Y""h@Y""@Y"#!@Y"#a@Y~"#Dې# @ @ '@`@( x@!2@!0#P2@!2@!a0 2@!X 2@!)2@!!32@!& $ #@wc# @n!&a0 $ !#,@ccG$ @Z!"a  ( @ @M!&` 8'@   `` !! ""  @*!.`  @!&U!, 4P#cp@ !&G04B"#!$ p &c/  8 !! @ ! @   `@!#&0E 4,##@! & ,c쀢 8+"c4c4 8/  @ ጔ @  `<.@,@ 8/  * +4@ 2+4 Ӹ,#/ @ ጔ @ ,# `@!,c` *0F 4##@o!&0cP 4&#|#!8/ @ ጔ @] ⴸ `!@K!+"c0@G!"d@C!+"(#X  @9!`&t4p@cȷ/   ጔ @- `@@!W4Tc/ @ @`/    `@""@!"&6-43"!|!| "!@!"&&-4#"b@!"&-4"P"@!`* !P 8Ϛb጑/   @ɒ P2!P .:!ϑ/  ጔ @  .*!@!"X@! &! $ #S@cn"bhbh ጔ @ bh  `@z!& $ #|@qc""" &?#'-cضa  ز#aPHcؤ"8x#',+c#80!a''''''';a  @6a @1 a @, @!a&] 4Y%@a%@a$@a&M 耢 8H$@!&A`耢 8<$@@!&5 42,@!&+ 4(-@@a#@a"@@a"@a"@a#@a#@@a#@a"@@a&@a& 8&' '` `''''''"  `  `` `@!&!34,"##  &/?#@{!&a34@q!&`耢 8)ሷ/`& @b!&4*"X& ,c  @Q!&@$ +#@Fc"c,c, &ጔ @< +#,  `@*!&f 4c!,#x #x,  @bpx @ ( @!&L ?4I&@@!&B ?4?&@!&8 45. cx  `ܴ@!&& 4##P@!& 耧8"a@!9 2 R2 @#Ÿ x"h"@K# & "# cP`۞ "#PY " #"x@J &@J#@Hx !ɠ! @g d@K,@Ho .@K(?@Hk .@K$?@Hg )cP 2 ""x "xb   : @U #!@v逐"!aj D@j逐"!@J U %@J;'("`$*#$`@J p@J,!!!@G !0@C#P!@@ !@<!0!@8#X!@5)!@2!3`@/!@,!!@(!   @@@a  ` = ጐ  "! ! " @'+?aR``"@! !  6@@a ` *@!!"  a` @@a Ǻ`@F!@JI @J q@JC #cp!@ #@ `cp" +"#(cp`&㈵/ `8    @   @   `c"+#(""#(`8/  2+ p "  @X,#!@!#+c4@}!+#0c4 8/  @ ጔ @D  `#@+0&@"0<.@ . +#4 2۸!,#+c0#@ "c0#/ @ ጔ @ ,c  `,%#c" ""dc#!!@&&#|@"!c8/ @ ጔ @ b  `&|"bd" "bd8/  2b#`#@#+c0!!@ %d@!'+(@!@Eɶ @Iw@I& @IYc0@F ,@IUd@F ,@IQ( cȨ ? !#լ?????@@2 ` 2` @  `@` `%@` `@ 2 2 @@ 2 `@` `a@$6 ጔ @O   ca`'@i 2!cY Ȓ/   #в? @  `@`@` @ 2 `@`a@3%6 ጔ @   cȶ a`@'$!|!@!"@!#aP@ !aP-" #XaP"b*ϔ/ @ @ "!!@! @˔ !X`"!X!P (aP`.:#ϑ/ ⸐ ጔ @  .*#aX!@!@D @HDaX@H  #bh@!bh# @ ጔ @ h  `!"@a" -#!Pٺc`H#,!ڶ8a`x#''+8`ሚc0  'ܠ ''''''ጔ  @Iጐ @C ጐ @= @`a@\a@@Xa@Ta@@Pa @La @Ha@Da@@@a@;a@6a@1a@,a@'a@"a@a@a@Gg @G~ @F@D =@@ " @GD u@@G? `''` ` ''''''   ``` ^`@C!"h@GD" @G  @G?"@G " ",@D s,#@a*bX) @ ሺ@  @ "  !!@@@!@! !3`!+#,@a#, &!#ጔ @e +,  `! #x@a #xcx,   #p @ !@n!@k!@@h! x  `@C?!,@F#@F!#耤 "@D) s@F!%+@F#,@F!A!@F #x@F!G #x "@D s#P!@9!!@5!!@1#9@!#aX㿠 "Ѐ'H  @i& 'ii6'i b)ϴ."@"+#(*`@.`+`@#@ @2 +@P8.[+Ϫb@@QaT "M.Ź/ " aPb2!`H+#!P#"!P#aP'Ϧ⸣,`@2P.&P"  *!j( @ %,@ `@  " @P/.ϒb% @㿠":*.ŀ!* "2 @E!t@E!{7@E!@E`&!"ȱ.  )%@Eڐ!!@EL& *@Eϐ!⸱. %耤@*@E!@E!@Eb@C$ 㿠":!:"@E$& : @E!@E&!@E!@E! @E!ϒb. @E< 㿠N ` N!7#!@Oǐ#(.@@,`@@$@ $  "а@`. *@ѐ "a +$`"  c(* " aϖ⸓*`"@ #a+  +a?,`,@a?*`"@㿠&#|" !0&#|8*`@ "#|ⴠ#P:"`"""#1,% "####쀢8 5@k!58/`&@㿠?'Dcc+4!<.`?@ / 2  /`a8@ +4 2`+##4`@@.$@`/`'@ /  @"'$ #'@a<.&'+$4@2`* 8@ @"*  +"c4c4,$c4* j" !<'`.&.`?@+4@ 2 2,?Z#c!#`@:J0#,c`@8D0',c耤 :,,#c  3 +4'< * ,+ #44*"  *`"@ !?#"@/ #@,&#@"*`"@*"K" !WcQ%8.&a<?* #@#@ +4  + ( 4 4 *"+ #8 @ '@`@('@!=??  './@` @  @%h$ ,$  ,$@ ,4$H ,5'?$` ,T+ ##4#4.`?&@ #4*#" #4#4 ,  $#4#4`-`%@#4,#"cc*"c*`"@ 0cF ` -`@*`@,c8*`@ @``@#`#`%p!$$ ,3?c,$0#P ,L ,M$H ,<=,'&$|+%b?/%3+ &c0 "bd㿠+#4%? * !8#4`+`#@#4"1-+)+#4:+ /8/ +c4%"c44*a8 @:  @`/`@ @*@ ,`@ @@$@'@2)+-+4 .a8@ @/?" @` + # @ .@ @2@ +c4.&c4 `*`"@㿠M#X8*  # * +!=-?'N&$x/`a< 2 *`@ *` @ @'N$x/`` 2 -=" /` `6' `/` "'/` " +N%4+N8`x"H-`@M"#T#TM#T M#cdN#|!#*/%<-@)N x2)N@`6|)N``/`  "t)NN | ?"o)NM#chN |%N" | |,@ |+Mcp' * K"/`<  2:N`|+-N/` x2H)NNMcp/   =/`@ 69)N%`, @@"1)N ?".)N.@&`&@ 2M"hN "|/` 2)N@ 2)N%8-!#*-@)N x")N | *+c:<-@ "  * wb ޸@ !8- @㿠N | & Mmc.@N|`@ `M#tN`| `&e)Mp @@@!3%N|`@`)a.@ "U#M`#(*/`@@N|" *F#M@!N |# 23@#Mcp   @ */#M@ 8N|`@ `#*bX."zm!֐"*@7 $% * !b  M#p/  @@@@@t!3 @%,@ `@ " @H' <. @ *%,@ @&#|'@"#|2%,耤32,!ܸ!3,#)a.` "#@ "R#*@#(- ` - +`@ /`@ @#$*#*@% " 8'@ @@**@ 8  `*.`"X )##$!3&`)a.` @ 2@#*bX'@'%  & "c; "o" " & "c "" " *`*@ *" + @ * + @ * @ @  'NȺ@2++ cx`2'0 x ,x xx*`"@ x,+ # x#bp, x/@ xcx.@@2,#@@2 p 2 4Ǹ' Ÿ"㿠uchn. @  p @!#@@ @@, , $@,`*,$*,` ,*,` * *!  @@#@#@Nз/`2'n/`'@% @2`p 2uch. @2 #c@24ֺ'`Ժ㿠2u ch. @ 㸺@ '@'@NȚ +@`@ (+@*xNu"ch@"n* (M c`#@`@ (#@M#` & Nb'M``@  M #c\#. !+ $#,@bP% $? '.$P@ @b &&&@'@`@`㿠n 'D M\@ :MM"\M#\'x㸙+ -#c@*L+c,' @6&.@&7+#c@7+,.&,,P+ #,,#, $,,-`" %@,27+.P/ @ 2$#.#n` @+,`c@" /`@ 4#n#.c. bP)N / $"Ч-$+n` @#-`@ @ @, $ @-`%@"㸻/`@ 2+n㿠uch. @ $N"З.  2_@2u㿠Nbг. @ #u#h.  n #+NbЦ@+ ,` $@`p,@   ,@ߐ  2u㿘@= Ӧ m*# ݪ+-! "    * }b 耐2 0*! 9(2a`.2! $!*  #2 ?#& "#c!"  #! ?!!M . p$ mc#@. mؖ"0 ?.  $Mct`2Mm+M#p.  2mm. mغ@ @ @|&'`@&` "@o&4'`@O !M#p.`u#h/` ` n @( c/`  4n" Mn @ :'@Mc`@2M#/nc@M`"``* " `uch/`# ' ' n /`p/ @&p@ @ "/@q#> &!#P#s" /@a`"#um*ذ  !"  * T#b@;#g &##cp# Rch$chch".!u#h#h.bP@ " N`@  2`N#"u#h'// 〻/`@@ '`'`+c, $*#x#"  @* *  ##c@``@$ $ *bX3)-+ %,a d''@`@ ,"c㿠 ^ " !@.c㿠 O " !@c㿠 @ " !@c㿠 1 " !@c㿠 " " !@c㿠  " !@c㿠""b & `& @ِ` "6‧2 %!"#bȀ2,1 'ἀ$5)" "!!!25#0!5"Ĵ.@"Ķ""Ė 2 "Ě#`"""bȀ 2 㿠!!"$@o? 2#"#"x"`""x"Ȁ bĀ !"к@@7N@%ĸ `@6Q"x""x㿠!!"$#@?@7?q 2@=#* ""Ā :%#b 2 %# "##Ā *%'Ā: @#!!㿠 !< /` / `+ / ?`, #$㿠p !<.  /@   + /@ #? ,`#$@$@㿠Y !<.  /  `? / @` + ##? @` -`@%`%`@` *`@"`"`㿠@9= !!<. @9E@6  @8㿠!9. ?  -`@ -` . @@@9@@9o㿠`(*`@ `!"#@ @ `%8. 9@8Ԑ 5+ `- 5" !8&. @   " 7@5W@9<@ @5J@9@8 ~ "`" 㿠6 @:``*``D Th|@8 @8 (@8 2 @8 >@8v P㿠2  _2 h s@8㿠a<. @ "  d* a8 xT,h@@8i K@8d F@8_ A@8Z <@8U 7@8P 2@8K -@8F (@8A #@8< @87 @82  @8-     @8" =@ @ " @`2 !@8 : ^ .  ^   _㿠@7! /`8@ @ @7ǐ!$#@# / a8@2`@2@2 @ " @7!. / @ 2`@ 2`@ 2 `@ " \@7!@ \   /㿠@7!S7!   D*   3' a @+`c@ @ `+ `+  `+ +  "+  ``21`7*@7`@*`@@ $   2  @ : 6 2  ' / ``2!!<. * ,a.` %@+ * *  * * @P+ +` +` +`+` ?2 *"  / + # "@  "@ "@ې 6   & "@   @`@$ "@   @`@$ "@8*`@ +`&  #@@, Ha8+# !*!8* ڐ" Hb* ؔ * *" *"㿘P. @ `-* * * **+`@5@-`@"@ + '8-`%@@ 7  *.& )+#8@ @/`@*`]"@* + , +$㿠 !8*`@@.`#@"@`.`@ . &㿸P.  `'* * * **/+8`-c 6`. 㿠 8/`@ @"d'@ +` @ "]'@ .  2   @ -`@c@ *&/` 2   )!P*-   *,`@@"@$@ &Ē ܐ a8/ % . @ @  @. @ @ 2@Ɛ a8. & @K 㿠!@ J"̐  +a8/`@@m @`+`#@``.`.  * 2! *`!8@@R@@`+` #@!8 - `,`$@!=  .2  . 0@Ր`, $ .  `-% 㿠a=. @ @c%@! . !8"&/@㿠#&cd`!!8*`)@'` `*"`$`` $`㿠K&`?7""ې㿠@OZ! T&c` P&#d  2e0˰ @# b!ؠ! +`@)`+`#@!  / !8 ̛+` , 0 -+0cF#@*z-!  / .@ &#h8*`"@ "#h㿠&cd``` "&h!<* 2 &h%+ + !`@N㿠$\! a !   '?$E ȕ*#$a@6*)!6 !ͱ!@ +@V%a!!8>. . : . ;  .   .㿠O !!8&ch`*`"@ ` +  &`` ,,`--``  `.`@&`&`ch` `+`@#`#``@`- %%` { `m`㿠! -M!@1!@0!@M !!8&h`*`"@` +  &`` ,,`--``  `.`@&`&`h` `+`@#`#``@`-%%`* "@5_```-`!1 `,!&&3a&&56 &7&ha!<. .h;a< ** &#h 㿠"#&ch8*`"@ ch+  /"$ch"h""h"h" * @1w"? 㿠k7@7 h"&.` /.aT %d%%%&#h * <" &#h! + !8##&ch)`,`!<$@+&ch1`-`!8%@"h&`""hh""*`  @1," 㿠&ch``  &h!<* *&h+ : '&h+a$/`? '#&cha8.& ch'* $chch`@$`-2 -!@'!@-7㿠!&cp `&  !0#F2 #F/  @v72  @5 !@y긐 &p "``!<* * ` , ,` , $`?. -%``@` *`@ "`"``Ȯ  ,, , ,, @ `. $. `. `..`,`$@%"   ͐   ɐ    @51 -&p3a- %5&p. &cp *` "@ @u䀢  "&㿠&#p"4&P&#p  *` "@  ?*  +`#@+&'cp?-&p-?/ @ "&L"#&#p@ @+ ##p'@#p*  " #h a8-`%@ ?*  D㿠! bt`t0#FM )")@."0@,;s7! '㿠!=. ?*@!"%ܞ+cȟ+"  䀐2&ǖ# @(ɐ @+i@@+1#@* @( )@ 7Ǎ5...8.D&  c ! *$%%#`x @) 8%+`/P-`@5@-`#@ @ `* `* `* * #`,` ,` ,`,`/ 耐  `@E 3a8&㿠 `  Ԧ     # `#`3` : * "b* ؒa * *c = $#!<. @ "  J* `, ?D\D\D\A8D\D\A8@8A D\A8=>=x=L<= CD= = CD==<====DH=  .@% * ` <<<<CD<CDCDCDCDCDCDCD<2@ -`-@ @`"@+@Aa= "+v@r@n@j@$f@Ab@l^  "  Ԁ 6 # `#`3` : * "b* ؒa * *c  |#*  &"+ 8#*`@ @"@+`?@ @#@ ԑ:   * c  >t>>>1/`!<@?@@. < 8  .@ Ԟ=.'@2&@/ @"@@ @!8/ @ @2@'@* ? $+`@ @$ @  @`c2+? `ʐf&/@܀ "@.``b2?@".`@ "@ .` 2@@&S'@`ǡ# 耐:+`*   3  * c  `@C`2 ؞ +  +  " +`!8@ 2`"]A8/  T" R P  M@  @ "`+`,"%``Ԁ`6 # " 2 :*# `"+`@ؖ +`@ `+`#@r "`# @ b ##-!8@  * c| BPALBXBdAL+a8& 2 * "+@+*`a8@ @ . `*$``*`@@@$ @ s!<. 8. 220< -`-@0cM8/ " "  Զ   # " 2 :*# `"+`@ؖ +`@ `+`#@ "` <.@ @ "   m* a GGGGG4GGG4GGGG4FtG4G@FFF,FFFFF<FLG@G@FDG@FXFXK @ G `C A ?  < @ ?5@"Բ 6 " # 3  ;+"`"* ؐ! * * # s #`/ '@/ "" 4"O3 `Ԁ`&. , * Ԁ&% # Ԁ&   Ա. cN & 0 . `  GTG\GxGG"Ƒ* # `!8. & / '  * * . !8 "/ '@@a8/ @ @ 2@"a8.@ @"6@`/`@ ` " `" 8/ 'a8. '2㿠`Ԑ :`*``N* -3b*ؘ! * * ܓ*- -  - a<& & 㿠 &`3`#b*`@%ؤ *`@)`*`#@*`%@!!8. %@`ܻ/`-.- -'@ @ . `ܸ .`@/ .`@ `.`@. .  '"& &&㿠 !<. .   "   !8,  . @'@~`*`@ ؞ *`@`*`@@'@@'&㿠! Բ :`*`` Զ 64!"* !ؠ! *)*# & '-ܭ- -- ܧ, ,, #`ܘ ,`@ ?`,`@`,`@@ %, +تa ,  ,  & ? @+`*  ؚa *  #a8+ %* ,`ܔ  * @@" $~!@!!8 ,`  $@-А/ " @  .`'@  '@㿘  耐8 *` *` *`*`!   8*   2F| ` ``2>! a,    ,  @ ` * `*  `* * `!۠#؛+`@ `逢@ 2 ꀢ*c0* ! * ` *Ւ`Ԑ :`*``8+`@  - !P-  #+c +` +` +`+`@ +`@@4 ` "ؘ! - @ @+c 6@`/`@  .8  2   +`@ "F ,@ `2?$+a8+##, $ $  * @`+`@#`#``&&` "" %`$@ `+`@@@%@@<`#a8+ /`|&@`*"' * #@$ @ " .``* *`"@ 6 ~%`+ * " #' . `&  &㿠 8.`@ @ 2!#b+ؔ + +&@! @k  ԑ* `"@  @k  ԑ* < ,  $ !8*`+`@@@@ 6@@HDԀ6!%"/`@ؒa /`@ `/`c@ ܥ,,  ,,  ", ؖ ,   , !#@"`*`@ ؞ *`@ ` b* #آa * /`@@ 2?#Ԁ6! ", ؖ ,   , !#@,`&`*`@ ؞ *`@`*`c *a8-  +  @"'@" {&@@=`Ԁ`6@@*  {@%"+ #آa +!#+8-`@ @-  ܞ, '@,$,&$"$&@|%<. ,** @ "*,`*`$@@, $@  @%'@}'@/`1"<@%) 9"+ #آa + ! + ##}#a8,# * "  ܩ- -  - @'@}~'@8/`#@8-$ * " Ԁ6 + ؐ! +  + #@ #b+ؔ + +@! ܔ %8/ $@ ܐ $ @ &@㿠a=.   2  Ԁ 6 / .!8@2s Ԁ6'  2! #,` `!=.!P* `*c @ `* `* `**`ࠓ*`@  `3`@ *`c `Ԗ a8*  " # " #`*  #"#`+`a8@`*`@!z"@ `ܠ"+`@ؖ +`@ !`+`#@`*" " %@`& 4!  Ԕ :`*`` @  Ը Դ< ,   {#a< * , +@+  * '@@ $'@, @@ $@@'@@@@ +z? &, `* *"  &@*, %-2 /  . a&*`@ؖ *`@  ` *`c +`@@ܶ"--  -  `*`@*`@ ` *`@ |!!8-#/ #/*  ؚa *   * c{ * " . & / b- ؐ! - -c @@&@a8, 2` ݉X%@, '#`ܦ * *ؖ   +  `ܸ#,`@,`@ ` ,`@  ؗ* ! * * {'8.&* "#`/*3زa *! *#{/``/`#@`ܣ,`@,`@` ,`@@@@%%@㿠'8 -`  + * . @``.`# `!"+`@'ئ +`@/`+`@ & @$ @e*!@e-`"@@&@ @6  `{a8.`&@ `.  & & "c  N" " `" " 㿐'H'Lٍ !!<,* * *?-""!4" "?"? "?"""   ,"0F# *B<.   !P.  ! + # * * **b @ *`@6 c @ *`@@$+ +8 . $8 # :2߀ +`!8@@ `*  * * 8 #$ " *`@ @@@$@@ "!8-@ @"  @-@ @2@ .  2'!!   +  *" ! ,  "-a   *  #a a +`@ 2-.  @ @ى  '@! + # "!  '@m!!< /`@?`*  +` `a(-`@ * @  "@ `!+`@ -`@   # d*G @  *`@ @@$ @ /  $63 + 8,  . 8  ch#`#` #ch!<. @ * a nhnhnhnnnq qqqpqqnh8.  2a " L a8+# LH*!8+`" #@@$@*`"@ +`+@  +@ a*H" $^4"  !0" a, "  ./?( . @ .@ "@#``+`$& #@ .a* ."  0# a(u0 @K d$!!@@! ! "  a " "  .!/ .  .@@ " #``@.+ ҝ. &.!.. &@ @6Oɀ2L8 "Fa&b0& 40dp #!0& / a8   /   2u / &"p . &@ @+!1atL'@ @!B0dZX!8Sau0 J@@ !N@. "@!d&  "` $!!@& ` @"!!@@"@g" 8* v@\w? 㿘'L'H'Pʐ !< -` . . `+ ?`, #$!4" "?"?"?! " "?"?   "?#*^א!Y *`@  +@/ `*  * . $[!W  . `*`@ ,` @`!(* /`@@ '@ @ `,`@ a/`@ @'@@ d*0!  .  $(!% .   / a<@ @ * b xtxtxtz<z<z<z<z<z<z<xyz<xt!!8@2P`* 8" `+ &# `, $ LH2%%`*` "@ `+`+@ +@  `* " $_!4 "  a0 " ,"  `.`.  a( .  /"#```,` $& $@ /`* .`" # !!8cπ a(s8 @. d$!ڐ!@@! "  ! " a "  `.` ! ..  -" #```.`+?@ҝ. &@-!`+`.`@&@ 6(ɀ2%8 "a #&@b8&!8 dY@@4!arU& @" 8dGE8 @asa8 7@@"@7 "!@".  "@"U#`& ` @3"n"q@@*"@x u[  㿘#Sa O?a ?0#Pc#''c "x"#!/ !<#a @@ 2`*"bb?*`@@`"@""@ 2 @`*a8 "! 2@`*a8 "! a`62 2@7  #!s %8/`'c``+`@*`@@@  #@ + " ## + #'"c`*8 %ۤd` $+  $&a<* :2@ ! &a8  `/  2@ a`&{`-`!8@ 2%@ǐ %=/`+` @ *!8/` +` @ := "} 8 .# '.. . @ِ"د- 2 / 8 '%8* . +  '-.a<&  ! 2q1#@_&%8 * ې#` . ## "   **`@ . @ "   " ""ː"@"@@< 2 ``+`@ ! "!+ ۔# c````" ``ɒa- " `/   `/  pʒ#@^-$̀4͖ `*a8 @@4 #`"@"#`c"-4`" # -  p* * " *` -͔`-8 "@ $`&`*`@`*@Ȓ(ɐ%ah $@!" -(p\#@^Q%(!(#``#@ "#` ,!8/`'@ '@!@"!a<. 2۴. a"a"@@/  * `D h<@6}ې#d ?6cl  p#t" `" #d ? " $ cd```"p`@6@4@ a@ &ɸ!h $@a 4#,#`"a"㸀@"<`+  #/`@ @2@4 @ɐa |!<.`@@ *M@ 8I@` 2%5<`+`@/ ۖ*c` *   *  " ``@ "`"")"@/p/`*u& / !8%ۤd $$c|@ $ې#d   "" " !a8+ # "!.`@ @#c &@8"'u㰀 2  200cO&#h#O"`X㿠0#MT"cp !8/ "/`'@' ,. $ 5.#@&+#/ . * .  %/ u7&  "<.  @ ` *`a PPPddd2㠁 㿘# " " " " " " a? `" 21H +    @@ " +`@ - :@4  2 /  2{@%  +` @ &"<.  @ * ch $$$$6G`@6 !a " ```&@   "$ ```"n`@6 @4@6@@4 @'"a(@"f$c<. @ @` *M@ 8I@` 2 7*` @/` `*+`?@`  "`*@`@"= "@ "#@nt!=/ +%`/`8@ `@@ "` $  "" . !8㿠'Hbس. @ $ "0!$&㈙+  2#@9V!$ a$,`@@%`$@!$"   &*  2@9?!( %!(+  $`#%$(2) !<.` "H&#2@#3@Ő#:@#D@K #`-?@ @22M'@a(!&#+`@ 2%@8!( (,%$ * 8 "!(!(!&#* "'8@/`!'@!!#a2#,? "!!&c*   "#a "%% &#,2@5!  % *#"%, 8"a a &㈓*`@ @`"@!. !8%,2'$H#2` 2&"h!#`X##a8+#"#. & !8"!8"8""8#a #$b%$8'$8"?c "0p"0N"#!?#c!$"#$a%$ '$|@ " # " #!c" 0%8.  0#P"c " 2! #&"  c* """6b8@ &8 @"8@א @8  #! "8?`""8&`"%?"" ""@5 y w.@-㨀 "&!# 2'` 2#!& $#ha% $Xa8,$ # 0" " N!$!!k"$"Ё& "c4  ]" " " & "c  " " & "c !L" " " & "c !" (" bd" " & "c ""  " cG" " & "c #" " & "c  " W" " 㿠!&#t'D "`?!8* #㠠? #c*& jA#&ha8,$ h-`@ 0"h#h<+   " j+#&ha8,`$@ h-  "h-&h* * h * nh? - nh -?%i !&#h), !!8!$@ %!+b0 -` @"%0?* "%!@ "0$"0%8)!=, ""8? * "!@ "8$"8"0  `-8 ,-`@!@" " " " " /` `* ?- % /  `+ *  #/ /`@#@"a"᠒a"`"`"`"` +b2^"x2 "a"h#!a &!! %$'ᨀ6!)"x&+bx"x ͐" "#"  p& x!$!X#b%$'9$b`+%b "!X`p` &xx ͐" !#@$! p& %x'$- +% "!! +  , #%a!* *$a%2)?'#+%a `"䀐 &` $@ː #!| h ## $a| $00#M'?ɿ -@`*!! #ad` " `+`#@ ` " "`*  ` #"`* ` # #`+  `@ "@ #`+ `@#@P#!! #`$` $` $` $`  $` >$`ő -8/`# + + !! #ad``" + # ``#*"  ``#@*"  ` `*`# "@  ``* " "  ``+$#&'` & !!"!a@ ! 4?: #a8!!8/`'$!8`McX/`'@ P`"PP ' .`'@ !8`+`#@`#@ /``+@+@ `*`"@ #@&@a` $@a&@#! -8/`#@ +@+@ #ad`!! `#*" ` `#@*" ` `# *`"@ `  `" * " ` `+" # ` `+`$@#@.`#'2@ᄀ@(!a@ (∀ 2 " ∯-`8- !d % $Kl !pat "&  䀧@4 D?@ 2H| "=! 27!8. 20@2- . @ $ h 6Զ ahb;` $Ͷ `c4ʶ ȶ x @$axb(` $  䀧@ 4x @ 4  p@O D" $?  $ ܴ& 2<.  @`2McX " ش a=.  &&&  $ a` $ D@y /`!8@ a. @@ 4 +`!8"@@!@& & ᠀@ 6#!28. @ .`@ & u@2H#`6>.&@X|.@ b :v *   l" x#b+ #+bx٫-`@`x`@%@ U.x* R"1"x ,`@ ` "x*   6#ْ`x x *  *#bx,`@ `@`$@)x. x*@G? x!"x%, @G4"x"  * `d P4 H"T""T㿠 @ [@@ ]㿠 耦* @ Đ". #(@ . '@ `@  :. a耦 2. x6. 㿠 耦* @ ". #(@ . '@ `@  :. a耦 2. x6. 㿠N N N 㿠#$bx` @ x|ܐ㿠!Ȑ oϐ㿠 Z - Ϻb @FH/@@FA  `@J㿠 A ->#$? '@@F' @F&    +b+␰ !Ϡ"@ @F/@@F  `@㿠 "ϐ" @  > /@ `@㿠ϐ"@'`O@&  O@ 0 74'`㿠6 d  d@E֐@Eϒ ܐ 0@E͒ א 0㿠#耦/"O&#* N@E"`0N2N@E"`0&N@N@E&0& O&4ڴ 㿠 (*    @ @  `㿠! a 9"@#@$ {!#! #$a! " 㿠! al=@$9㿠!,8/ "@ N!,"3 2-a@!!& 2-@}%8/ '+a)&#* $ N޸ "ٶ@$/, @#k  @"  㿠ѐ"@㿠!!" C C* a 00$LL  X@c@ 2 @ !ǘ `* !"!5$": !+@/`c@5"!(&a@/`@ #a " '{"@!@#%$! $G)! G: @|-+a@#Ȼ/`@" #"@#x#@ !m"!$b'Ȼ/`@+%a-%5Ȼ/`@"a "cȻ/`@ !$!% $)#Ȼ/`@-%5 &&#`&&&c`` "%&" Nk@ "!#! #$!#$bp`'$+ %b-%&--``P %% %% %%., @& @ @@&&@@  2'`..\  #!b#b2#8!$!a%$'T$)!2 ۀ2/+c- %%#`/`@" <#"b 2! #"%<, )%!+*%b@-5ح-2 "a!#*a8*"!+ %b-/%5 &@8 "h#* " !%*  "!$@2 !+bH,5"!&!۔ؑ*  #!#b@R ** c ,Ll!#ɢa+"!!-ͬ- "!!*   #!!!"+`@"!'$)! 2-+%a%/5&&#hc :Q!&&` 2BJ!&&ha<* 2!!&#h ,  +%a-&h5<-  2z!&ch`*`@p##h%<,   2i!&ch - "!ch*` @`c2[! V#! Ѐ "!&M!#` 2I!&#h ?@"@!'):%!+a -5%/∴"0!"*"a!逢 쀢 "5?!!~"!jKa# @#@y "" #"#a#!"$#b`2 /!)!@,"!⠀2xb&"bb@4#"*5&!1U!&!!!@,   + #!!.-` %@!!.  +  # ! "!"  a8*`@ @`"@㿠@!&a` #@!!$!㿠@v!&a` ߐ#-@u!n!$!㿠@_!&a` Ȑ#?@!W!$!㿠@H!&a` #J@!@!$!㿠@1!& a@  #]@Y!'!$!㿠@!& a@  #k@ !!$!㿠"!  a` -2 2  ,+#!al+`2C@>!!#:%'$)! 8"++a`2!! " `" "` : #!# !$!a)$@ %!+a` !#~@-@ o%/ ! C* a`X8 A  "a33l' #!  $!%"2 /+) %!o/-% !,0:!0* !!,98!a #l0! 2E#akF8 +%A*+'$7alF83-A*./%7a @&!4 `4ᴀ "!#@ #!!@@a$!" !#@@ ! "@! "!㿠'H""倐  *a  -2 2  ,+#a+!! C /#a`X+  { %& !!+a@.X!$!" "!b "a!W]!] "!T!@<,2,.#a."#' $a%$',2-+,.%a- 20!/.2+!@ݺ ϐ"q@ 90 !#,0/@`^9(Q "!@!!6 H2  ! "!H"(#ʀ""+ -a #΀"6-- 2#F#@ ! *!a C ! X(@2Xh#2*-b 2/J  b`& ))!#a@.W!%!)" " ++ +aؐ! --#  #آa +++c/ "@@U@QQA"a" 2-   @=#- -"*~耢"#'! Qo#.$.b & +  +`@?" < : 5`4`@@=`< -`"$Ґ 22o-̐ 5"- dG;Ð 8" ?  ;"/ 6; >")- ; A" ;?# D"$$ G"$ J8 MA g@ -'P$@>b+`@> < : 5`4`@@=`< -`"$-/&ϐ "b!*"! "!@!"2#a&'% +&L t@-R/%""! "!㿠 2   a` -2 2  ,+#!al+C &!! X"K#b`& '%Y5U⠀2   %@  ! "!QG `758- %"  e`*`"@  ᬐ /`+ "/  O'`, $- /`-/%㿠P! #2 *`8"f "@ !8#+`bf,#@$a8-`.`/` @ @ r@ ";   !! e'@2 _ ".   #a R&2 L 2 F    % :'2˔ 4 2ؔ . 2 & "c  " " & "c !'" " & "cC !" " & "c !" " & "c "" " & "cD "{" " & "c ""  " " & "cA" & "ce #" " c" " & "c-" & "cb  " " a" a7" l" " & "c !" " & "c" & "c1 "f" " b" " & "c #=" t" c" " & "cڐ  " " & "c/  \" " * (@  *  Ђ`@ @  @" `@  `  c(*`` *`@@@(* "@ " " @`@@ @ @"  ` ` 㿠 "0 2 x֒  ! (+ # " 㿠N *@    " N2㿠" "` ` 6` ` ^* ``"`` ^,``@"``-@` "`27Ɛ  ``.` "```$Ԁ` "a㿠"# "ƒcT@< {+?0#N" &c`#a "` "`"`"`"`5&@7&"""Ȁ!6"Ȓb* "Ȕ#""Ȁ!& #Ȑ# !*  " +2)"c/"@/% 7 &x9!2 !@2 ;2@;^ b"#b`"!  c @`&2.5@;C 2@;; @;J!#  @:5)'㰨"  2 5# "   @*)5&7#' "##b* P 2! #bx $"x@#  @:;)'㰨" -7ȧ,";;c'`@@ 㻠@O@`O@`/"`O@\2O@`O@`2O@& c`"ȀP#b@K-2( @`O@2O@@& @@:ː`@:! @:@: &  d"`!"8`@:@: ޺` @M"@/-ĸ  h``"Ā$ & "`""ĞР /@& `#b%Ȁ@$  ') %# 㿘@'@:``* * "@ ɐ!" ` " ` " `gl" 㿠@: 㿠!c 2 p( Ր   "pې" 7 )쀐 "5!!!!ba h#H " !'#H!1b!8`+`@'$Hb -  1&"b.`@"bb쀐 2Ѐ "`Ѐ"#P 6`bx`2 `' !B$x` $x`A㿠" @ " @9  `c =!! "! !" ,3aV``"   6  ! `+@!  @9a@9!"x&`""x"x   !w! ."@O@9k Ё㿠_e{@Pg$@ :!"a㿠ƒcT@9  "`ȁ㿠@9    @9``4  @9| 2   !@9B!"!Ԓ" !͒2'!`(*`@ -x %x'+,,%a@%x/-@9>@9?!㿘! q* ǒa< P0|@ '&%h#X * !8"@ hT`+` #@h/0,N$! @Ð $  @ 5&ha.!8<&@ &h*a82"  @1 !  $ @#&ch+a`)!8,`$@-;/!&#h@#hP#h$#h78/` '@@e6"㿠a< .`` * * &#h+ # "#h㿠/=.  8-ǒc|   @y"  K = . /`@ @ @g" . L"@\"$ . L ",㿠!=.  M* Ȓ`  !!`!  !8+  `*`@ . "`"` `-`@%`-%`z !8 . )&#,`$ -%%b !8 .  `+`@#`#`"5㿠/=.  /-Ȓa !" "t"  $ * @&㈙+  2@@m@ /`@@%`'@   M":㿠'=. @@ * Ȓb """$ w .@,<@k#b.@"@)"@7\@`2Y&@8"#X .  #cT""0"0'က2-)#\+%b0-T/က2!"cT#XcTo0  '@!"cT#XcT]0 '@c\@"?'@!" . &@"P㿠! &D!6  "$& #a&h'%<+#㿠i`.`<@  :k 2 - *㿠@ !&#/ "}@'@ 8'@ 7‘* " @  %8* @ @!{* $@ &#`"#`3b5& @ @ B!"&Q"U@W@ 4&@##`bx# . a<)"/`"`-%x2 /x25 &xؐ"n!!8*  &%@T \@!"x㿠"xb " !"x#b zQ" "x$bb⌀@" ##b'⌒ zA"b$#bx3  $bx. a89 8. !" %" @ $bx*"o#c(+'$)-#pp -@#p9ܲ`"#p#p"2'x6'p*)ܞ# *p`$pp"2x!#pp -@#p9ܲ`"#p#p"2x *  x." (+ '#`@#p@+ݪcp-#p7ܮ"#p#p✀2'w'  `9 c(/  "& "cy "" " `'D'H'L'P'y "" '""씢 ""  @5"`8b@b욣` "@"""  @5j""."얢`"   " ? @5S"`8b잣 """"  @5<". ""옣  ""`"`"   @5&"`85쐢  ""`"`"   @5"b-`@b욣`"@ @"""  @4"`8"@"쒢` "bb"`  @4".`@@88쐢  ""`"`"   @4"`8""얢 "  " ? @4".`@'"@"쒢` "bb"`  @4"`8""옣  ""`"`"   @4y".`@'""씢 ""  @4a"`8pb@b욣` "@"""  @4I".`@'""얢 "  " ? @41"`8@잣 """"  @4".` @'""옣  ""`"`"   @4"`8쐢  ""`"`"   @3".`@'b@b욣` "@"""  @3"`8"@"쒢` "bb"`  @3".`@'잣 """"  @3" `8""씢 ""  @3".`@'쐢  ""`"`"   @3u"`8""얢 "  " ? @3]"ܔ`$  .`   @@ @ 2W&& ' " '" " bha@@ *-͐"D =HLP & b"DP]" " V"P숐 P"@S" 'h+ aP ""@@b@` #@@@ "+ c8 "@@@ ࠞ#! # 0 ",! "ؚa ` ' ""씢 ""  @2"b@b욣` "@"""  @2""@"쒢` "bb"`  @2"""옣  ""`"`"   @2k"/ה/// !/ /  / / 쐢  ""`"`"   @2F" 4U""얢 "  " ? @2."".@"쒢` " bb"`  @2".잣 " """  @2" 2 .@ & `(f잣 """"  @1" ""씢 ""  @1"b @b욣` "@"""  @1"" @"쒢` "bb"`  @1" /ך/// @ `+ `+  `'``+ + ۚ`/`'@ P<" ـ6 C#ْc'@ hPb@ @ '@c. Ť b@b욣` "@"""  @1[""`@"쒢` "bb"`  @1F""`"옣  ""`"`"   @11"`쐢  ""`"`"   @1"`//ז// + +  + + @ :6 : :5 8  " >䀧@ :8̀@ :3̀@*@8"h&@:@*  * * **֐  2"h&@*@h" @ "̰  ?   = /`@0k!@0m",`@ ሢ@@ .w@ b@b욣` "@"""  @0v"" @"쒢` "bb"`  @0a"" "옣  ""`"`"   @0L" 쐢  ""`"`"   @07"@0W#`@0S#d @0N`d2  2  @/`2/''@@ `b- #*`@ 2 + 2+#8 +  2  * 2!0 .|@ "@"쒢` "bb"`  @/""`"옣  ""`"`"   @/"`쐢  ""`"`"   @/""`"얢 "  " ? @/"`/מ/// * *  *  * 8 : @*@8@ : `䀐"؀*w0,`@ ,!@ @# .t@""얢 "  " ? @/@" 잣 """"  @/," ""씢 ""  @/"b @b욣` "@"""  @/"@/##`@/#d @/`d2  2  @.Ē2''@@ `,ᐯ-ؒa  #@.` 쐢  ""`"`"   @.""`"얢 "  " ? @."`잣 """"  @." ""씢 ""  @."`/ך/// @ `+ `+ `++*8~" *x8u" @*o8l@*i@8f`@ } ظ ؚa @.  2e쐢  ""`"`"   @.-"``$'a""얢 "  " ? @.""/`@"쒢`" @bb"`  @-".잣`" """  @-" 2 .#*~" "@"쒢` "bb"`  @-"""옣  ""`"`"   @-"쐢  ""`"`"   @-"""얢 "  " ? @-"@-#`@-#d@-`d2 2  @-M "* "2}" * #&"  @( S2j `4 ؘ! /  #``+# * -/ 'ɖ"H'۔' Hژ"8' Lٞ'cx/@ /@ ' !P #""ሖ "0, ؚa # "" '"h ""h#b@,"#DĐ =HL|P& %# >VP #% " #(PK  "#1#V  @!m㿠! a`W2V2!a`U2 m!!'@/`@:#@ @ +%a㿠!!!4hN""%-`4%-`&%-`ر. "%-D&%-.@(-'+b63-h/(%a5h2#ɒa"h* " "h#"h@`'@@25!"h%$ $ -%/3bh傐#噐#.  i#-. a#@㿠ax` . ]#ҐJ#ږ8 א ! 㿠c@ `@8 x@ @*P. @@'+` @ "  !<.`-@ -@  "bh -" +c#ؠ -#$bH?'$ب?+%a & "c  ." f" `" " & "cՐ !" 1" ab" a" " & "cː !" " & "c5 "`" " 㿠!@$!T $!T 2 %!+ #$a'+%a㿘    ///c"@       !# #"#  @8" # "*c "a #a "  /* Ւa U[[``Z`Y`ThZ``Y`ZZU[[[[Z[Y[ThTh[[Y`ZZU[[[[[[Y[ThTh[[Y`ZZ#  @("# c@"*c ` 2 *#2*c* 2i㴀@ 8d"и "aa@*`#@ `  㴀@("в@@ 23 20 㴀@ :+  @ "!! @:?@.@ a?#`@.@ c " "c"ȸ@ ?"""ȶ@ c@ 8`. "'`㰖@ (D3cc;'@ #E&cbж  23‧ 20#@ :+` "aa`@:@. #@. #`"`"#"ȸ """ȶ @ 8L`. 3cb !"`c&c#̙+  3&a?*#a`p*@7`"  `+  3&a *  &*ca`p*@㰘"  2$c``` : @: 㰞 @#!c` @ #`@"# "#*#Y"@D3_&`̔ j&`+c "!# `"? #a u"!# `X"?# 7 "?!|`&3* &a. #!a`p*X@T! N" *c! G" ! # B" +!`" ;"`8*#*   (P"""c"ᰀ 2 #(+ \ "@  "a " )!"@) "$@@:! &a`$##"#c*@ c` #c"` ""#!b "@Px6'#P $Ea &#"## ?@/"޽3c`"b"7&`! &`a`$``#&`c*@ c` #"` "Ȁ "had㰀 r3c&㈻/`@c8*`@ @c =&c7'@&#̓*` @3&a?."a`p*Ua`s  &c+ 7#&#  + 3&a."aa`c(8"!1#a@e.7`"`" "!  " ! #" c@ "`*`0@@a @! 1a` -! )&x2t# + a< 3&a!*" a`?2!.* @* !#ก㿠&#x"` ""1& 㨀  #  c`(+@#`%!&#@*  #@+ %a/ %1&#x $j@53`2#85&#C}X#d@&#x"  A* ؒb bc c@c#u&c/`"}/" ܐ#&a#/`"  p!"$!!&ΐ##"}/`@$@+`8/`/%1?/!%3! &`ැ#&#"}/`& @ଐ##@} "%|#bNʐ h##D@ ""##` !$!@:% $́㿠""c@ SPO #  :'#  !"Ѐ@ %`@  '!$"O#n+b"Ȁ@&/1"Ā@63bи7b@ж& . bĺ`@  # !"%Ȟ#" 㿠#" !#8*`@ "#!0: `"  #p% "#p#p#p2 3@*#~+ 3`8/`&"#!0"?"cpcp! 8/ %&@  @'@&)#p' '`&+a-%@1+ &#(& "c    @"  j"  `" " & "c А  !" " & "c 7  !n"  " " 㿠    * !}’ 0`8. # #c(++`'&` 2l* #2Q 8/`@ @#c"@! 8. &%&/`$@+` ް'+c(,/%㿠( ے " &Ea08. 'b`2)#'a%!&#@.+#!'+a-`@ !3c2 `8/` ##" 8&.&c /  /`$@232"x ""x" &* ڒb jjjk;!7! ! !a !a9=!6""x㿠 @ 㿠! "* ڒc kkkkkk!&#x$#x $#x # 2"x ""x N/ ے`< lTlhl|llmL!?E!:#`" 0! +@'!!)ڨ"8* !/ۮ-`@!7ٶ, " Y!a*`6@ Q"##"x @/ 㿠"&& "cx "x #c"aa%&, $a p,0j)!# N+a`9-`a`29!!%8/ '!#&c* #@/ '* .J$2 - zV"@sz\"  zH"$@Y@"!Ź/ 8' &!!* #" !#:+! 8/ '%&* .$@)! 2  z"N! `@@" z!| )! ca`lV ` 8/ ' ! c8_:#!! :&4">/a`+)%K'')!,0( +a@( y"a#@-@%!$"+/  8' &!!㈛* #@#& $cx'8/ '+&c* %㿠 &"cx ""aa)&#+ #a%8/ '* .$ $ !۵-Р#%!`"@"`"@ !@"c2P$  "9%ي?] ".%z"*%‣   2!&@#e & 2%@#[ &!! "%@#! y" "@Wy$`%'$!&a`$#""##b+ c`% $"*` m/  8' &#a* ㈸#@a@#!`@u%'$&"#x!"`㿠  0 #""T T62"T#""T !""P"P @6' @$P 쀦(& i"ٔ. @ @*@@. d'@S@. ` 55 W"HɐDŐÐ>ۿ ٯ 05٫ !<۲ ١ 91$ " )"% -ݒb uuuuuuuuvxuuuv0vd`8 2 "㿠2 Ӑ"`8.   _#㿠!!Ia! n* P :Y!a`mE :N!*  +``8@ 2+ # "& "c   #7" "  & "c\" & "c   #" " & "c  ! " !V" " !& "c" 㿠"b """ 2! yz "%+`+`!!@@#`#` #`#` #`"""" "!**  c"`"` "`"` "`㿠`#* `"  :* &c.  @` #@#a%.$'8+%c-P$w&! р` `" !/Ӓ@I G !! Ґ !ې w# 5&㿠 # *59 c`8#0&#* 2# )㬟+ $#) # +a-@!7%"!!0* +# !" c`Ȁ y㿠 # c   #"U!&㈕/`" !# ! $ "  "  #* " * " 㿠!$ Ē v$ ā㿠!$ Ē * v$ ā㿠 #c  #   @6 #2㿠#4 2! xH bȀa2!! x?!!#4%۔$#4#4#* #b+#'Ȫ " *?" 㿠!# "b ?"* #  # c'(,`@ n@#4% "#4㿠&#x 4!ܐ &#x"  "* ߒc| !ټ!a!ٶ! 0!ٰ!/!٪!$!9 ?B/`8@ 2 6㿠""**!  "" "" 'а@"b-- -  #"  "  "  " " b@"'! #2 '# c`2'%"'$T)"x+ c"-8'!/㸀2!"2!!L!)H!-D!7c`2 *#_" ֻ >2!>o"ֲ "T""T #bx#P#!#b '2+)#c`$/㬀@6@ "T#""T !""P"P @' @$P؈`@ !!Ar!!Mm)#2!!!Ycܐ!j_!א!~Zc#S!ː!N!Ɛ!I!!D!ؼ!?!ط!:!ز!5!ح!0!ب!+!أ!&!؞!!!ؙ" # * `    Xl(<"T""T ""x"bP :#`8* ac#x!"P2"T%$"T !""P"P @6 @""PbTP@ 6T"" P!"#%@ 4!)"  @""- @&`b :2 :*" "Xՠ b`@ &ԣ  & Փ `@@4%!"@$$-@6=2 : * bX%s `@&@$!Ր"  㨀 "# 8 #b "#"#A""b',`,`@@@`+c%``%`` %``%` %`lx jboQdޔe920T 8,&8D<PU\ShFtDcT  &0AdOZE-;nCk1~4!-`AA6//BVf!9rr>(C*G}p ]~2JG.s|OP$)(8X#<9z"A.3%k 7up?SWn 5[p#7@> W{b6 18b"+')03ddN?!lR_V<j QQDw$Nh3fvm2*"T Y6~2bU,1);EmM> %H+Z]nVOxJDr[05{s^6" &,/9: =@BFIEKLNP_QTQW\^aacheghi0jloqt6ux yLz|$ `Xe4 0*JF"a7H&Kw+UF'cvJ{7CIiSH:<MRYU=y ;    \Pkt q!#%&z'(g)*,-.C/|0124589o:;<B=>y?5@ABCDEFmGHIKLMNORSTUX}YZ[\]^_`abcefgiVjkolmo qstuvSwxyfz}{#]'nY3(&.D - : dI^Wx2+TM}1|%  ,#4L\`t$8@ X   R K~:*cp= !l"s#$% &Z'()?*u+,-.e/013457r89:G;<7=g>P?_@4B2DEFhGjH[IJKLMNOPQRSTUVwWXYvZ[q\i]^_`abcde$fghijklmnopqrst(uvwxyz{|}~ 6 !&+ /9 83'5);-     ,%. !"#$%&'()*+,-./01234567 8 b%,~h2r;9EKM[ gVbx Pr"  T FX (\ ` Eb\ {xW &|Ot , %C+/ )8 pP>Dz(PXW Ltb ts4_~ t:tNt tYl_P|F)FP j4~(S%FK3 Qt >:hH+S *t8] He-wowf\(*D_@*}4P|h }If  W{ (wQt)C4pDJ$0PQ4Xf Io#\~ GI 4I IcET- \I ,|K3H I( I8f)P+ c:(ElNRVFjlw c})NoTFFrGLH*H8< >H >J I>rI zEN- >> 2>G d>M&Yd]_(m T{  +l,]!<^cMhLLM O,& @0tA6OVL|d fntTx wZP>HU^h?h8P\+T| NfT{U$% T1[</YG\R  i^t\$a l(`]PLW8R< tGSQpP Pd` ?G, 7JH9FS(_ Ll<v'~7 .N 0^dyzdLp D '8 ;WL M [s i} wT Pv@ QP S 0   U@  C < " P ) ; HS F) Q% ` a r  ~0  2 ul 4}X f    cs y<  a & a 1< A2Q Pm| [ a jbz sW Q( {D 4  a  a  jX kx l +  I4 += ;/ K8 [F j w T Ba Ia k  Yd rD cx dx 8  ex  e| $F8 8AP E me O e Z g e ?j8 pT| {5YT   Ol  Yn c | @$ nո!fS+ n1 Nn;֜E nMF߸\g&r =o} oD(fߘ oH|ר Z0SN oL voPw E/ oT9 oXCO,TyQe*u' zc o\a  o` o!X,(7[ESpaTPo\y vo_D_ X}lNp8 /T. 9PD OnxYu^8d onyiLX o: L   o-@ oKqqV zoa6Ll,{wd &r0~L (r4. r8UL r< *r@$ .rD0 rH: rLD orPN X b `rTl !rXo r\x sr` ~rd Urh $rl~  rp" ?  %rt jrx ~r| xr ]r ^r pr |r  r j  r l1 r< rGDR !ta th uo/([ | u u u c, u wh7L wp  l pR'8?4-96 xAHPJ"RZ:xhr:psVGNMVsOxU:la nn^h W8`X Bb ..aD< nCPaU(at` >h ^y vqa ``3~Db< h} ],g^9zF7"O0Q]TxT&0+yv2y C,!bx$ +0 ,`##$3 BwzU'xdHDo 9 @xLt0yx=@  4 70! 0. #? LPZ4gkLu kp( n   [ 0 >$O- : DN Xl y e } V   o }3F~d+`L6 iDL^xT]_ j Byll`  gy| (H H !(P5"ؼAGYYXQ `d[pgTw h &p Dp bxN x  *nYP X ( , 0 Q4 8  p/8 D!L X =a enzdx >H P:l 7T r7X#  (P!,x<7B-hL 7\V 27``j 7dn 7hr 7pv 8xz 8|~ 8X 8 B8 C:i<  G  `h WTp Vs8   0$DdU; dSoJ zD$   B6l56 $6 6L 0" p @  J  [`5T i}5 w m  <4 6  .5 R;0 ZP S e h k!k`!39(!:aX!#P6!.c!<L<!J3Kx!X)c!f^c!t !|l`!FN!I! S!dJ8!$! <!! " "p" "+A"@,"U"c "n "|""|"5`"  "" $"up" (#R##[#/ ,#@ؠ#M  0#W A4#h 8#q R@# tP# ?T# ,X# `# '|# /#o# # $ol$$) E$7<$F $X W$j "$uפ$ -$ @$ U$ $ $$ $ 0$ %\d% 5 %! %1 C%= mP%J%[ T%b X%m `%z| (%o %L%L%l % % %f%{ l% X%@ &d & &" &1&J T&V &b <&ra t&{M|& &G&&/R8&l& f&)&&L&?&'T'' '/'7'?$'G'Ok '\|'a'n''{%x'k*'$'%'wS0'R'WS`''HR' 'VgX(a(g(#-g(/x(@xh(RVx(]h(gx(wx8( 0(|y( O( 4(?y_etext_edata_endstartstart_float__exit_main_environ__DYNAMIC_exit_new_save_level_save_stack_delete_glue_ref_cur_head_push_alignment_cur_tail_cur_span_cur_loop_cur_list_help_fin_display_align_flush_node_list_scanner_status_get_node_avail_new_penalty_help_ptr_init_col_init_row_tok_mem_nest_begin_token_list_error_align_ptr_pack_begin_line_confusion_cur_align_cur_group_new_glue_nest_ptr_hpack_eq_define_pop_nest_help_fin_display_help_align_apply_scan_left_brace_free_node_fin_align_get_avail_get_token_new_null_box_help_line_save_ptr_init_span_tok_link_cur_cs_vpackage_expand_normal_paragraph_print_align_peek_build_page_back_error_back_input_total_shrink_new_token_print_esc_print_err_push_nest_flush_math_flush_list_geq_define_scan_spec_scan_glue_do_assignments_init_align_resume_after_display_cur_cmd_pop_alignment_cur_tok_cur_val_cur_chr_help_preamble_missing_scan_optional_equals_align_state_adjust_tail_fin_col_fin_row_total_stretch_mem_get_preamble_token_append_to_vlist_warning_index_help_display_align_unsave_help_preamble_many_get_x_token_eqtb_new_param_glue.rem_half_round_decimals_print_scaled_x_over_n_nx_plus_y_print_val_dig.div_remainder_badness_arith_error_xn_over_d.mul_print_char_new_skip_param_depth_threshold_mem_end_hash_show_insertion_show_node_list_copy_whatsit_str_ptr_tok_end_print_ASCII_print_style_show_fraction_noad_show_discretionary_free_whatsit_show_adjust_new_spec_new_disc_new_rule_new_math_new_kern_print_ln_pool_ptr_show_token_list_print_font_and_char_new_ligature_str_pool_show_box_temp_ptr_show_leaders_show_whatsit_show_penalty_print_skip_param_print_rule_dimen_print_str_print_int_show_normal_noad_show_choice_node_copy_node_list_show_box1_hi_mem_min_show_glue_show_rule_show_math_font_in_short_display_show_mark_show_kern_show_info_str_start_print_cur_str_show_ligature_show_glue_set_short_display_breadth_max_print_spec_print_glue_print_mark_no_align_error_help_csname_height_base_hyphen_char_help_vsplit_help_output_scan_dimen_italic_base_cs_error_build_discretionary_end_graf_package_help_insert_255_width_base_scan_rule_spec_make_accent_indent_in_hmode_help_tab_help_box_help_head_for_vmode_help_output_balance_scan_eight_bit_int_begin_diagnostic_help_pandora_help_noalign_help_leaders_box_error_begin_box_char_base_cur_input_new_noad_new_graf_append_discretionary_off_save_print_nl_help_missing_the_help_group_close_help_close_group_help_align_error_help_delete_last_font_info_fin_mlist_build_choices_insert_penalties_append_italic_correction_help_disc_help_omit_scan_int_ship_out_scan_box_ins_error_last_glue_help_align_cr_scan_keyword_make_mark_extra_right_brace_you_cant_page_tail_par_token_append_penalty_new_character_scan_toks_output_active_box_end_end_diagnostic_eq_word_define_end_token_list_print_cmd_chr_cur_box_unpackage_def_ref_do_endv_append_glue_append_kern_align_error_line_break_help_space_fac_help_math_disc_head_for_vmode_help_lastbox_m_help_lastbox_v_scan_char_num_delete_last_begin_insert_or_adjust_omit_error_error_count_param_base_handle_right_brace_help_fix_alignment_help_discretionary_vsplit_xord_xchr_init_char_shown_mode_par_loc_print_length_param_print_param_null_str_font_area_font_size_font_name_init_cmds_no_new_control_sequence_primitive_print_hex_font_dsize_show_cur_cmd_chr_write_loc_print_size_print_mode_make_str_given_cond_ptr_get_x_token_or_active_char_get_next_line_if_limit_pop_cond_cur_if_help_relation_push_cond_pass_text_read_open_skip_line_conditional_help_or_if_line_scan_four_bit_int_change_if_limit_help_poirot_help_prefix_shift_case_str_eq_str_mag_set_interaction_token_show_pack_file_name_cur_area_cur_name_find_font_dimen_geq_word_define_read_font_info_help_missing_cs_scan_file_name_do_register_command_font_ptr_trap_zero_glue_help_mag_str_tex_prepare_mag_page_so_far_job_name_scan_seven_bit_int_new_interaction_a_open_in_alter_aux_help_err_msg_help_ill_mag_help_read_to_help_font_at_make_str_term_offset_new_font_help_font_magnification_overflow_new_hyph_exceptions_alter_integer_help_show_online.udiv_show_activities_scan_font_ident_clopen_stream_new_patterns_help_code_help_pref_help_show_selector_int_error_tok_head_report_illegal_case_the_toks_alter_page_so_far_give_err_help_name_in_progress_help_prevgraf_help_register_help_overflow_fclose_fflush_issue_message_prefixed_command_use_err_help_help_space_factor_read_file_read_toks_skew_char_sprint_cs_open_log_file_print_meaning_cur_ext_scan_fifteen_bit_int_after_token__iob_show_whatever_dead_cycles_alter_prev_graf_alter_box_dimen_long_help_seen_file_offset_get_r_token_str_texput_dvi_gone_dvi_name_dvi_file_dvi_swap_dvi_four_down_ptr_c_rule_wd_rule_dp_rule_ht_str_dvi_f_dvi_font_def_old_setting_out_whatsit_init_dvi_g_cur_h_cur_s_cur_v_dvi_f_dvi_h_dvi_v_last_bop_max_push_movement_total_pages_prune_movements_dvi_limit_font_used_hlist_out_doing_leaders_max_h_max_v_make_name_string_fwrite_b_open_out_prompt_file_name_lq_lr_dvi_offset_print_two_font_check_right_ptr_start_dvi_pack_job_name_dvi_buf_dvi_pop_dvi_ptr_vlist_out_help_huge_page_fin_dvi_xeq_level_init_eq_save_for_after_cur_boundary_cur_level_help_offsave_missing_eq_destroy_help_offsave_xtra_eq_save_max_save_stack_help_broken_base_ptr_term_input_normalize_selector_last_jump_out_pause_for_instructions_help_wounded_help_no_help_first_help_delete_text_help_help_buffer_OK_to_interrupt_interrupt_help_capacity_show_context_deletions_allowed_init_error_close_files_and_terminate_begin_file_reading_help_interrupt_history_clear_for_error_prompt_print_menu_fatal_error_help_dollar_math_ac_char_warning_scan_twenty_seven_bit_int_sub_sup_do_extension_math_left_right_app_space_start_eq_no_x_token_its_all_over_font_glue_math_radical_main_control_init_math_kern_base_after_math_new_style_append_choices_lig_kern_base_help_illegal_case_math_fraction_scan_math_math_limit_switch_font_bc_font_ec_set_math_char_privileged_insert_dollar_sign_print_totals_page_contents_max_nest_stack_help_undefd_cur_mark_help_match_xtra_runaway_param_stack_max_param_stack_runaway_arg_help_runaway_start_input_ins_the_toks_insert_relax_cur_order_conv_toks_print_cs_force_eof_cur_val_level_id_lookup_help_extra_if_radix_param_ptr_max_buf_stack_help_match_pstack_long_state_macro_call_help_cs_input_stack_cur_path_end_name_fmt_file_pack_buffered_name_name_length_str_log_str_tfm_str_fmt_input_ln_job_area_format_ident_puts_log_file_log_name_fopen_fputs_test_access_end_file_reading_print_file_name_copy_path_firm_up_the_line_font_path_name_of_file_access_banner_init_file_input_ptr_ext_delimiter_get_real_name_a_open_out_set_def_area_begin_name_more_name_getenv_area_delimiter__flsbuf_set_paths_open_fmt_file_input_file_input_path_w_open_in_fprintf_strcpy_format_path_sort_avail_getw_cs_count_dyn_used_w_open_out_store_fmt_file_fmem_ptr_hyf_next_tok_low_putw_hyf_distance_fread_trie_op_ptr_trie_hyph_word_hash_used_hyph_list_tok_used_trie_max_var_used_rover_depth_base_exten_base_load_fmt_file__filbuf_hyph_count_printf_lo_mem_max_hyf_num_font_params_str_eq_buf_slow_print_init_mem_max_var_used_trie_taken_new_trie_op_hyf_char_cur_p_init_pattern_memory_help_hyph_lccode.urem_first_fit_init_trie_memory_compress_trie_hyphenate_help_hyph_init_hyph_try_hyph_trie_min_trie_ptr_trie_fix_ha_hb_hc_hf_hn_hu_reconstitute_hyphen_passed_trie_op_hash_trie_node_trie_hash_trie_pack_hyf_trie_c_trie_l_trie_o_trie_r_b_open_in_init_terminal_char_box_overbar_stack_into_box_print_fam_and_char_print_delimiter_fraction_rule_math_glue_math_kern_rebox_height_plus_depth_new_choice_var_delimiter_empty_field_print_subsidiary_data_null_character_help_doldol_help_limits_help_double_sub_help_double_sup_help_xtra_right_scan_delimiter_just_box_mlist_penalties_help_math_ex_help_math_sy_cur_style_cur_mlist_help_math_accent_help_fraction_push_math_help_delimiter_mlist_to_hlist_make_op_cur_size_cur_c_cur_f_cur_i_make_left_right_fetch_make_ord_clean_box_math_spacing_make_radical_make_vcenter_make_scripts_magic_offset_cur_mu_help_undefd_mathchar_make_math_accent_make_over_make_fraction_make_under_show_split_page_max_depth_prune_page_top_vert_break_active_width_help_tut_least_page_cost_help_inf_shrink_ins_help_inf_shrink_box_help_box_255_best_size_last_penalty_help_dead_cycles_help_vsplit_vbox_show_page_stats_help_inf_shrink_page_last_kern_freeze_page_specs_cur_page_depth_fire_up_best_height_plus_depth_ensure_vbox_print_plus_best_page_break_help_shrink_best_bet_fewest_demerits_passive_best_pl_line_pass_number_actual_looseness_first_indent_cur_active_width_second_pass_best_line_post_line_break_easy_line_no_shrink_error_yet_show_break_node_set_break_width_printed_node_finite_shrink_minimal_demerits_minimum_demerits_line_diff_update_printed_node_second_width_background_best_place_disc_width_threshold_try_break_last_special_line_second_indent_break_width_show_break_status_first_width_print_the_digs_write_file_trick_count_print_roman_int_tally_trick_buf_first_count_help_number_help_char_const_help_reg_help_del_help_aux_help_missing_number_help_big_num_mu_error_help_thee_help_char_help_left_help_char_num_help_mathchar_help_mu_error_scan_something_internal_help_filll_help_dimen_help_big_dimen_help_mu_init_strings_write_open_sprintf_strncmp_init_tfm_begintime_init_tok_mem_call_edit_time_final_cleanup_localtime_fix_date_and_time_handle_int_initialize_ready_already_signal_system_strlen_strcat_decode_args_one_new_whatsit_out_special_print_write_help_unbal_write_new_write_out_write_help_font_param_help_tfm_help_font_cs.umul_help_font_tfm_file_help_scanner_check_outer_validity_help_skif_help_funny_help_left_brace_help_param_count_help_read_str_toks_help_param_use_help_param_num_max_in_stack_pop_input_line_stack_in_open_push_inputҼc $Ҭ\`gidD(`㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠 㿠 㿠 㿠 㿠 㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠 ??Improper halign inside $$'sMissing # inserted in alignment preambleOnly one # is allowed per tabendvExtra alignment tab has been changed to cr256 spansalign1align0Missing $$ insertedDisplay math should end with $$Displays can use special alignments (like \eqalignno)only if nothing but the alignment itself is between $$'s.So I've deleted the formulas that preceded this alignment.Displays can use special alignments (like \eqalignno)only if nothing but the alignment itself is between $$'s.There should be exactly one # between &'s, when an\halign or \valign is being set up. In this case you hadnone, so I've put one in; maybe that will work.There should be exactly one # between &'s, when an\halign or \valign is being set up. In this case you hadmore than one, so I'm ignoring all but the first.You have given more \span or & marks than there werein the preamble to the \halign or \valign now in progress.So I'll assume that you meant to type \cr instead.The `$' that I just saw supposedly matches a previous `$$'.So I shall assume that you typed `$$' both times.@ӈ@?CLOBBERED.CLOBBERED.foulfil plus minus []hvunsetbox()x ( columns), stretch , shrink , shifted , glue set - < -rule()xinsert, natural size ; split(); float cost leaders gluenonscriptmskipmukern (for accent)mkernmumathonoff, surrounded (ligature discretionary replacing penalty markvadjust []Bad link, display aborted.etc.Unknown node type!flushingcopying@@?Too many }'sUnbalanced output routineOutput routine didn't use all of box255Missing cr insertedrightbraceExtra }, or forgotten endgrouprighttospreadA was supposed to be heretoMissing `to' insertedLeaders not followed by proper glueYou can't use `hrule' here except with leadersYou can't insertTry `I\kern-\lastkern' instead.Perhaps you can make the output routine do it.Incompatible list can't be unboxedImproper discretionary listThe following discretionary sublist has been deleted:Illegal math discretionaryDiscretionary list is too longMisplaced Missing { insertedMissing } insertedMisplaced noalignMisplaced omitExtra endcsnameTo put a horizontal rule in an hbox or an alignment,you should use \leaders or \hrulefill (see The TeXbook).You've closed more groups than you opened.Such booboos are generally harmless, so keep going.Your sneaky output routine has fewer real {'s than }'s.I can't handle that very well; good luck.Your \output commands should empty \box255,e.g., by saying `\shipout\box255'.Proceed; I'll discard its present contents.I've deleted a group-closing symbol because it seems to bespurious, as in `$x}$'. But perhaps the } is legitimate andyou forgot something else, as in `\hbox{$x}'. In such casesthe way to recover is to insert both the forgotten and thedeleted material, e.g., by typing `I$}'.You should say `\leaders '.I found the , but there's no suitable, so I'm ignoring these leaders.Sorry; this \lastbox will be void.Sorry...I usually can't take things from the current page.This \lastbox will therefore be void.I'm working on `\vsplit to ';will look for the next.I was expecting to see \hbox or \vbox or \copy or \box orsomething like that. So you might find something missing inyour output. But keep trying; you can fix this later.I'm changing to \insert0; box 255 is special.I allow only values in the range 1..65536 here.Sorry...I usually can't take things from the current page.Try `I\vskip-\lastskip' instead.Sorry, Pandora. (You sneaky devil.)I refuse to unbox an \hbox in vertical mode or vice versa.And I can't open any boxes in math mode.Sorry: The third part of a discretionary break must beempty, in math formulas. I had to delete your third part.Discretionary lists must contain only boxes and kerns.Wow---I never thought anybody would tweak me here.You can't seriously need such a huge discretionary list?Please dont say \count or \dimen or \skip in the midst ofa paragraph or formula. I'm going to assume that youmeant to say `\the\count' or `\the\dimen' or `\the\skip',I can't figure out why you would want to use a tab markhere. If you just want an ampersand, the remedy issimple: Just type `I\&' now. But if some right braceup above has ended a previous alignment prematurely,you're probably due for more error messages, and youmight try typing `S' now just to see what is salvageable.I can't figure out why you would want to use a tab markor \cr or \span just now. If something like a right braceup above has ended a previous alignment prematurely,you're probably due for more error messages, and youmight try typing `S' now just to see what is salvageable.I'm guessing that you meant to end an alignment here.I've put in what seems to be necessary to fixthe current column of the current alignment.Try to go on, since this might almost work.I expect to see \noalign only after the \cr ofan alignment. Proceed, and I'll ignore this case.I expect to see \omit only after tab marks or the \cr ofan alignment. Proceed, and I'll ignore this case.I'm ignoring this, since I wasn't doing a \csname.{: relaxbegin-group character end-group character math shift character spanalignment tab character crcrcrmacro parameter character superscript character subscript character end of alignment templateblank space the letter the character skipmuskiptoksoutputeverypareverymatheverydisplayeveryhboxeveryvboxeveryjobeverycrerrhelpcountdimenaccentadvanceafterassignmentaftergroupfontdimenbegingrouppenaltycharcsnamefontdelimiterdivideendcsnameendgroup expandafterinputendinputhalignhruleignorespacesinsert/marktopmarkfirstmarkbotmarksplitfirstmarksplitbotmarkmathaccentmathcharmathchoicemultiplynoalignnoexpandnonscriptomitradicalreadsetboxprevgrafparshapethetoksvadjustvalignvcentervruleparprevdepthspacefactordeadcyclesinsertpenaltieswdhtdppagegoalpagetotalpagestretchpagefilstretchpagefillstretchpagefilllstretchpageshrinklastpenaltylastkernlastskipcountdimenskipmuskipnumberromannumeralstringmeaningfontnamejobnameififcatifnumifdimifoddifvmodeifhmodeifmmodeifinnerifvoidifhboxifvboxifxifeofiftrueiffalseifcasefiorelselongouterglobaldefgdefedefxdeffutureletletchardefmathchardefcountdefdimendefskipdefmuskipdeftoksdefcharmathcharcatcodemathcodelccodeuccodesfcodedelcodeselect font at ptskewcharhyphencharpatternshyphenationbatchmodenonstopscrollmodeerrorstopmodecloseinopeninmessageerrmessagelowercaseuppercaseshowboxshowtheshowlistsshowundefinedmacrolong macroouter macrolongouter macroouter endtemplatedumpendhskiphfilhfillhsshfilnegvskipvfilvfillvssvfilnegmskipkernmkernmoveleftmoverightraiselowerboxcopylastboxvsplitvtopvboxhboxleaderscleadersxleadersshipoutnoindentindentunskipunkernunpenaltyunhcopyunhboxunvcopyunvbox-discretionaryleqnoeqnomathordmathopmathbinmathrelmathopenmathclosemathpunctmathinnerunderlineoverlinelimitsnolimitsdisplaylimitsoveratopabovewithdelimsoverwithdelimsatopwithdelimsaboveleftrightopenoutwritecloseoutspecialimmediatelineskipbaselineskipparskipabovedisplayskipabovedisplayshortskipbelowdisplayskipbelowdisplayshortskipleftskiprightskiptopskipsplittopskiptabskipspaceskipxspaceskipparfillskipthinmuskipmedmuskipthickmuskipoutputeverycreverypareverymatheverydisplayeveryhboxeveryvboxeveryjoberrhelppretolerancetolerancelinepenaltyhyphenpenaltyexhyphenpenaltyclubpenaltywidowpenaltydisplaywidowpenaltybrokenpenaltybinoppenaltyrelpenaltypredisplaypenaltypostdisplaypenaltyinterlinepenaltydoublehyphendemeritsfinalhyphendemeritsadjdemeritsmagdelimiterfactorloosenesstimedaymonthyearshowboxbreadthshowboxdepthhbadnessvbadnesspausingtracingonlinetracingmacrostracingstatstracingoutputtracingparagraphstracingpagestracinglostcharstracingcommandstracingrestoresuchyphoutputpenaltymaxdeadcyclesfloatingpenaltyglobaldefsfamescapechardefaulthyphenchardefaultskewcharendlinecharnewlinecharparindentmathsurroundlineskiplimithsizevsizemaxdepthsplitmaxdepthboxmaxdepthhfuzzvfuzzdelimitershortfallnulldelimiterspacescriptspacepredisplaysizedisplaywidthdisplayindentoverfullrulehangafterhangindenthoffsetvoffset /accentadvanceafterassignmentaftergroupbegingroupcharcsnamefontfontdimennullfontdelimiterdivideendcsnameendgroupendgroupexpandafterhalignhruleignorespacesinsertmarktopmarkfirstmarkbotmarksplitfirstmarksplitbotmarkmathaccentmathcharmathchoicemultiplynoalignnoexpandnotexpanded:nonscriptomitparshapepenaltyprevgrafradicalreadrelaxrelaxsetboxthetoksvadjustvalignvcentervruleparcountdimenskipmuskipspacefactorprevdepthdeadcyclesinsertpenaltieswdhtdppagegoalpagetotalpagestretchpagefilstretchpagefillstretchpagefilllstretchpageshrinkpagedepthlastpenaltylastkernlastskipinputendinputnumberromannumeralstringmeaningfontnamejobnameififcatifnumifdimifoddifvmodeifhmodeifmmodeifinnerifvoidifhboxifvboxifxifeofiftrueiffalseifcasefifiorelsehskiphfilhfillhsshfilnegvskipvfilvfillvssvfilnegmskipkernmkernmoveleftmoverightraiselowerboxcopylastboxvsplitvtopvboxhboxindentnoindentshipoutleaderscleadersxleadersunpenaltyunkernunskipunhboxunhcopyunvboxunvcopydiscretionary-eqnoleqnomathordmathopmathbinmathrelmathopenmathclosemathpunctmathinnerunderlineoverlinedisplaylimitslimitsnolimitsdisplaystyletextstylescriptstylescriptscriptstyleaboveoveratopabovewithdelimsoverwithdelimsatopwithdelimsleftrightrightspancrcrcrendtemplatelongouterglobaldefgdefedefxdefletfutureletchardefmathchardefcountdefdimendefskipdefmuskipdeftoksdefcatcodemathcodelccodeuccodesfcodedelcodetextfontscriptfontscriptscriptfonthyphenationpatternshyphencharskewcharbatchmodenonstopmodescrollmodeerrorstopmodecloseinopeninmessageerrmessagelowercaseuppercaseshowshowboxshowtheshowlistsopenoutwriteendwritecloseoutspecialimmediateenddumpinaccessibleifMissing = inserted for {case {true}{false}Extra orI'm ignoring this; it doesn't match any \if.I was expecting to see `<', `=', or `>'. Didn't.Missing control sequence insertedYou can't use a prefix with `'You can't use `long' or `outer' with `'toMissing `to' insertedInvalid code (), should be in the range 0..), should be at most prefixYou can't use `' after byArithmetic overflowBad space factorBad prevgrafFONTFONTpool_sizeatImproper `at' size (pt), replaced by 10ptscaledIllegal magnification has been changed to 1000Incompatible magnification (); the previous value will be retainedIllegal magnification has been changed to 1000pool_size> \boxvoid> > OK (see the transcript file)Please don't say `\def cs{...}', say `\def\cs{...}'.I've inserted an inaccessible control sequence so that yourdefinition will be completed without mixing me up too badly.You can recover graciously from this error, if you'recareful; see exercise 27.2 in The TeXbook.I'll pretend you didn't say \long or \outer or \global.I'll pretend you didn't say \long or \outer here.You should have said `\read to \cs'.I'm going to look for the \cs now.I'm going to use 0 instead of that illegal code value.I'm forgetting what you said and not changing anything.I allow only values in the range 1..32767 here.I allow only nonnegative values here.I can't carry out that multiplication or division,since the result is out of range.I can only handle fonts at positive sizes that areless than 2048pt, so I've changed what you said to 10pt.The magnification ratio must be between 1 and 32768.I can handle only one magnification ratio per job. So I'vereverted to the magnification you used earlier on this run.The magnification ratio must be between 1 and 32768.(That was another \errmessage.)This error message was generated by an \errmessagecommand, so I can't give any explicit help.Pretend that you're Hercule Poirot: Examine all clues,and deduce the truth by order and method.This isn't an error message; I'm just \showing something.Type `I\show...' to show more (e.g., \show\cs,\showthe\count10, \showbox255, \showlists).This isn't an error message; I'm just \showing something.Type `I\show...' to show more (e.g., \show\cs,\showthe\count10, \showbox255, \showlists).And type `I\tracingonline=1\show...' to show boxes andlists on your terminal as well as in the transcript file.??vlistoutCompleted box being shipped outHuge page cannot be shipped outThe following box has been deleted:file name for output Common TeX output No pages of output.Output written on ( page, bytes).The page just created is more than 18 feet tall ormore than 18 feet wide, so I suspect something went wrong.lineskipbaselineskipparskipabovedisplayskipbelowdisplayskipabovedisplayshortskipbelowdisplayshortskipleftskiprightskiptopskipsplittopskiptabskipspaceskipxspaceskipparfillskipthinmuskipmedmuskipthickmuskip[unknown glue parameter!]pretolerancetolerancelinepenaltyhyphenpenaltyexhyphenpenaltyclubpenaltywidowpenaltydisplaywidowpenaltybrokenpenaltybinoppenaltyrelpenaltypredisplaypenaltypostdisplaypenaltyinterlinepenaltydoublehyphendemeritsfinalhyphendemeritsadjdemeritsmagdelimiterfactorloosenesstimedaymonthyearshowboxbreadthshowboxdepthhbadnessvbadnesspausetracingonlinetracingmacrostracingstatstracingparagraphstracingpagestracingoutputtracinglostcharstracingcommandstracingrestoresuchyphoutputpenaltymaxdeadcycleshangafterfloatingpenaltyglobaldefsfamescapechardefaulthyphenchardefaultskewcharendlinecharnewlinechar[unknown integer parameter!]parindentmathsurroundlineskiplimithsizevsizemaxdepthsplitmaxdepthboxmaxdepthhfuzzvfuzzdelimitershortfallnulldelimiterspacescriptspacepredisplaysizedisplayindentdisplaywidthoverfullrulehangindenthoffsetvoffset[unknown dimen parameter!]save sizegrouping levelssave sizesave sizecurlevelExtra Missing groupendright. insertedThings are pretty mixed up, but I think the worst is over.I've inserted something that you may have forgotten.(See the above.)With luck, this will get me unwedged. But if youreally didn't forget anything, try typing `2' now; thenmy insertion and my current dilemma will both disappear.! ? insert>OK, entering batchmodenonstopmodescrollmode...(That makes 100 errors; please try again.)Type to proceed, S to scroll future error messages,R to run without stopping, Q to run quietly,I to insert something, E to edit your file,1 or ... or 9 to ignore the next 1 to 9 tokens of inputH for help, X to quit. (Emergency stopTeX capacity exceeded, sorry [This can't happen (I can't go on meeting you like thisInterruptionI have just deleted some text, as you asked.You can now delete more, or insert, or whatever.Sorry, I don't know how to help in this situation.Maybe you should try asking a human?Sorry, I already gave what help I could...Maybe you should try asking a human?An error might have occurred before I noticed any problems.``If all else fails, read the instructions.''If you really absolutely need more capacity,you can ask a wizard to enlarge me.I'm broken. Please show this to someone who can fix can fixOne of your faux pas seems to have wounded me deeply...in fact, I'm barely conscious. Please fix it and try again.You rang?Try to insert some instructions for me (e.g., `I\showlists),unless you just want to quit by typing `X'.Missing $ insertedYou can't use `' in I've inserted a begin-math/end-math symbol since I thinkyou left one out. Proceed, with fingers crossed.Sorry, but I'm not programmed to handle this case;I'll just pretend that you didn't ask for it.If you're in the wrong mode, you might be able toreturn to the right one by typing `I}' or `I$' or `I\par'.semantic nest sizeverticalhorizontaldisplay mathnointernal verticalrestricted horizontalmath mode### entered at line (\output routine)### current page: (held over for next output)total height goal height insert adds , # might split### recent contributions:prevdepth ignored, prevgraf linespacefactor this will be denominator of:Missing endcsname insertedbuffer sizeExtra Undefined control sequenceUse of doesn't match its definitionArgument of has an extra }<-parameter stack sizeParagraph ended before was completeI suspect you've forgotten a `}', causing me to apply thiscontrol sequence to too much text. How can we recover?My plan is to forget the whole thing and hope for the best.If you say, e.g., `\def\a1{...}', then you must alwaysput `1' after `\a', since control sequence names aremade up of letters only. The macro here has not beenfollowed by the required stuff, so I'm ignoring it.I've run across a `}' that doesn't seem to match anything.For example, `\def\a#1{...}' and `\a}' would producethis error. If you simply proceed now, the `\par' thatI've just inserted will cause me to report a runawayargument that might be the root of the problem. But ifyour `}' was spurious, just type `2' and it will go away.The control sequence at the end of the top lineof your error message was never \def'ed. If you havemisspelled it (e.g., `\hobx'), type `I' and the correctspelling (e.g., `I\hbox'). Otherwise just continue,and I'll forget about whatever was undefined.The control sequence marked shouldnot appear between \csname and \endcsname.I'm ignoring this; it doesn't match any \if....pool_sizenumber of stringsfile name sizepool_size! I can't find file `! I can't write on file `'.Please type another *** (job aborted, file error in nonstop mode): input file nametranscript file name (no format preloaded)JANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDEC**Sorry, I can't find that format, will try PLAIN.plain.fmtI can't find the PLAIN format file!TEXINPUTSTEXFONTSTEXFORMATS! Environment search path is too big def_areadef_areadef_areadef_areawreal_namereal_namereal_namereal_namereal_namereal_name.tex.dvi.log.tfm.fmttexput---! Must increase the %s string pool size---! Must increase the %s max strings---! Must increase the %s font mem size---! Must increase the %s font max---! Must increase the %s trie size(Fatal format file error; I'm stymied)! You can't \dump inside a group`{...\dump}' is a no-no. (preloaded format=pool_sizeformat file nameBeginning to dump on file strings of total length memory locations dumped; current usage is multiletter control sequences\font at pt words of font info for preloaded font hyphenation exceptionHyphenation trie of length has op hash sizepool_sizecsnameendcsnameIMPOSSIBLE.IMPOSSIBLE.NONEXISTENT.csnameendcsnamemain memory sizemain memory sizeNot a letterpool_sizeexception dictionaryImproper hyphenation will be flushedLetters in \hyphenation words must have \lccode > 0Proceed; I'll ignore the character I just read.Hyphenation exceptions must contain only lettersand hyphens. But continue; I'll forgive and forget.pattern memoryNonletter(See Appendix H.)pattern memoryDuplicate pattern(See Appendix H.)Bad patterns(See Appendix H.)rwrwrwbuffer size! End of file on the terminal** ! End of file on the terminal...why?Please type the name of your input file.fam []{}displaystyletextstylescriptstylescriptscriptstyleUnknown style!textfontscriptfontscriptscriptfontmathordmathopmathbinmathrelmathopenmathclosemathpunctmathinneroverlineunderlinevcenterradicalaccentleftrightlimitsnolimitsfraction, thickness = default, left-delimiter , right-delimiter mathchoiceLimit controls must follow a math operatorMissing delimiter (. inserted)Please use mathaccent for accents in math modeDouble superscriptDouble subscriptAmbiguous; you need another { and }rightExtra rightMath formula deleted: Insufficient symbol fontsMath formula deleted: Insufficient extension fontsDisplay math should end with $$displayI'm changing \accent to \mathaccent here; wish me luck.(Accents are not the same in formulas as they are in text.)Sorry, but I can't typeset math unless \textfont 2and \scriptfont 2 and \scriptscriptfont 2 have allthe \fontdimen values needed in math symbol fonts.Sorry, but I can't typeset math unless \textfont 3and \scriptfont 3 and \scriptscriptfont 3 have allthe \fontdimen values needed in math extension fonts.I'm ignoring this misplaced \limits or \nolimits command.I was expecting to see something like `(' or `\{' or`\}' here. If you typed, e.g., `{' instead of `\{', youshould probably delete the `{' by typing `1' now, so thatbraces don't get unbalanced. Otherwise just proceed.Acceptable delimiters are characters whose \delcode isnonnegative, or you can use `\delimiter '.I'm ignoring this fraction specification, since I don'tknow whether a construction like `x \over y \over z'means `{x \over y} \over z' or `x \over {y \over z}'.I'm ignoring a \right that had no matching \left.The `$' that I just saw supposedly matches a previous `$$'.So I shall assume that you typed `$$' both times.I treat `x_1_2' essentially like `x_1{}_2'.I treat `x^1^2' essentially like `x^1{}^2'.0234000122*4000133**3**344*0400400*000000234000111*1111112341011p is undefined (character mlist1mlist2mlist3mlist4vcenterSomewhere in the math formula just ended, you used thestated character from an undefined font family. For example,plain TeX doesn't allow \it or \sl in subscripts. Proceed,and I'll try to forget that I needed that character.??UnderfullLoose \hbox (badness Overfull \hbox (pt too wideTight \hbox (badness ) has occurred while \output is active) in paragraph at lines ) in alignment at lines --) detected at line vpackUnderfullLoose \vbox (badness Overfull \vbox (pt too highTight \vbox (badness ) has occurred while \output is active) in alignment at lines --) detected at line Infinite glue shrinkage inserted from skippageInfinite glue shrinkage found on current pagepruningvertbreakInfinite glue shrinkage found in box being splitvsplit needs a vbox%% goal height=, max depth=The following box has been deleted:Insertions can only be added to a vbox plus filfillfilll minus % split to p=% t= g= b= p= c=box255 is not voidOutput loop--- consecutive dead cyclesTut tut: You're trying to \insert into a\box register that now contains an \hbox.Proceed, and I'll discard its present contents.The box you are trying to split is an \hbox.I can't split such a box, so I'll leave it alone.The correction glue for page breaking with insertionsmust have finite shrinkability. But you may proceed,since the offensive shrinkability has been made finite.The box you are \vsplitting contains some infinitelyshrinkable glue, e.g., `\vss' or `\vskip 0pt minus 1fil'.Such glue doesn't belong there; but you can safely proceed,since the offensive shrinkability has been made finite.The page about to be output contains some infinitelyshrinkable glue, e.g., `\vss' or `\vskip 0pt minus 1fil'.Such glue doesn't belong there; but you can safely proceed,since the offensive shrinkability has been made finite.You shouldn't use \box255 except in \output routines.Proceed, and I'll discard its present contents.I've concluded that your \output is awry; it never does a\shipout, so I'm shipping \box255 out myself. Next timeincrease \maxdeadcycles if you want me to be more patient!@firstpassdisc3paragraph@secondpassline breakingdisc1disc2@@: line t= -> @@0@parpenaltydiscretionarykernmath via @@ b= p= d=Infinite glue shrinkage found in a paragraphThe paragraph just ended includes some glue that hasinfinite shrinkability, e.g., `\hskip 0pt minus 1fil'.Such glue doesn't belong there---it allows a paragraphof any length to fit on one line. But it's safe to proceed,since the offensive shrinkability has been made finite.????????????m2d5c2l5x2v5iMissing { insertedIncompatible glue unitsMissing number, treated as zeroImproper You can't use `' after theBad character codeBad register codeBad numberBad character codeBad math codeBad delimiter codeImproper alphabetic constantNumber too bigMissing number, treated as zerofillIllegal unit of measure (replaced by filll)emexmuIllegal unit of measure (mu inserted)trueptinpccmmmbpddccspIllegal unit of measure (pt inserted)Dimension too largeplusminuswidthheightdepthA numeric math code must be between 0 and 32767.I changed this one to zero.Since I expected to read a number between 0 and 15,I changed this one to zero.The numeric code for a character must be between 0 and 255.I changed this one to zero.A character number must be between 0 and 255.I changed this one to zero.A one-character control sequence belongs after a ` mark.So I'm essentially inserting \0 here.I can only go up to 2147483647='17777777777="7FFFFFFF,so I'm using that number instead of yours.A number should have been here; I inserted `0'.(If you can't figure out why I needed to see a number,look up `weird error' in the index to The TeXbook.)I dddon't go any higher than filll.The unit of measurement in math glue must be mu.To recover gracefully from this error, it's best todelete the erroneous units; e.g., type `2' to deletetwo letters. (See Chapter 27 of The TeXbook.)I'm going to assume that 1mu=1pt when they're mixed.Dimensions can be in units of em, ex, in, pt, pc,cm, mm, dd, cc, bp, or sp; but yours is a new one!I'll assume that you meant to say pt, for printers' points.To recover gracefully from this error, it's best todelete the erroneous units; e.g., type `2' to deletetwo letters. (See Chapter 27 of The TeXbook.)I can't work with sizes bigger than about 19 feet.Continue and I'll use the largest value I can.I'm forgetting what you said and using zero instead.A left brace was mandatory here, so I've put one in.You might want to delete and/or insert some correctionsso that I will find a matching right brace soon.(If you're confused by all this, try typing `I}' now.)You can refer to \spacefactor only in horizontal mode;you can refer to \prevdepth only in vertical mode; andneither of these is meaningful inside \write. SoI'm forgetting what you said and using zero instead.A numeric delimiter code must be between 0 and 2^{27}-1.I changed this one to zero.A register number must be between 0 and 255.I changed this one to zero.number of strings^^?This is Common TeX, Version 2.9 (no format preloaded):usage: %s [ -d dir ] [ file ] (end occurred inside a group at level (end occurred when on line was incomplete)(see the transcript file for additional information)Transcript written on (INITEX)/usr/ucb/vi +%d %sTEXEDIT%d%sEdit format consists of 1 filename and 1 linenumberTrouble executing editorext1openoutwritecloseoutspecialwhatsit?ext2ext3output file nameext4Unbalanced write commandpool_sizeOn this page there's a \write with fewer real {'s than }'s.I can't handle that very well; good luck.Font at pt scaled not loaded: No more room.Font at pt scaled not loadable: Bad metric (TFM) file not loadable: Metric (TFM) file not foundMissing font identifierfont_memory! Font has only fontdimen parametersMissing character: There is no in font I'm afraid I won't be able to make use of this font,because my memory for character-size data is too small.If you're really stuck, ask a wizard to enlarge me.Or maybe try `I\font='.I wasn't able to read the size data for this font,so I will ignore the font specification.[Wizards can fix TFM files using TFtoPL/PLtoTF.]You might try inserting a different font spec;e.g., type `I\font='.To increase the number of font parameters, you mustuse \fontdimen immediately after the \font is loaded.I was looking for a control sequence whosecurrent meaning has been defined by \font.Text line contains an invalid character(Please type a command or say `\end')**** (job aborted, no legal \end found)(interwoven alignment preambles are not allowed)File endedForbidden control sequence found while scanning definitionusepreambletext of Incomplete ; all text was ignored after line The file ended while I was skipping conditional text.=>token memory sizeI suspect you have forgotten a `}', causing meto read past where you wanted me to stop.I'll try to recover; but if the error is serious,you'd better type `E' or `X' now and fix your file.A funny symbol that I can't read has just been input.Continue, and I'll forget that it ever happened.A forbidden control sequence occurred in skipped text.This kind of error happens when you say `\if...' and forgetthe matching `\fi'. I've inserted a `\fi'; this might work.pool_sizeptptmu at ptYou already have nine parametersParameters must be numbered consecutivelyMissing { insertedIllegal parameter number in definition of =*** (cannot \read from terminal in nonstop modes)File ended within readCLOBBERED.BAD.->BAD.ETC.(null)I've inserted the digit you should have used after the #.Type `1' to delete what you did use.I'm going to ignore the # sign you just used.Where was the left brace? You said something like `\def\a}',which I'm going to interpret as `\def\a{}'.You meant to type ## instead of #, right?Or maybe a } was forgotten somewhere earlier, and thingsare all screwed up? I'm going to assume that you meant ##.This \read has unbalanced braces.B@input stack sizemarkwrite->text input levelsbuffer_sizeRunaway definitionargumentpreambletext<*>